KEGG   Pseudomonas stutzeri RCH2: Psest_3523Help
Entry
Psest_3523        CDS       T02391                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Psest_3523
Enzymes [BR:psh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Psest_3523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3703148..3704728
Genome map
AA seq 526 aa AA seqDB search
MTTISSETPINGKSPVHLALRRVAIDTYRENVAYLHRDCAACRAEGFQALAKVEIRVNGK
RILASLNLVDDPAIVGCDELGLSEDAFAQLGAEAGVPASISQAEPAASIPALHRKIAGER
LRREDFLAIMRDIAEHRYSKIELTAFVVACNQGELDREEVFFLTDAMIQVGRRLDWREHP
VVDKHCIGGIPGNRTSMLVVPIVAAHGMLCPKTSSRAITSPAGTADTMEVLANVELPFER
LCEMVREERGCLAWGGTSELSPADDVLIAVERPLSIDSPGQMVASILSKKIAAGSTHLLL
DIPIGPTAKVRSMAEAQRLRKLFEFVASRLGLTLDVVITDGRQPIGNGIGPVLEARDVMQ
VLQNDPAAPIDLRQKALRLAGRMLEFDPDVRGGDGYAIARDILDSGRALKKMHSIIAAQG
SKPFDHNHPPLARLSFDVLAERSAVVTGIDNLQLARIARLAGAPKVQGAGVDILRKLGEP
VQAGDCLYRVYADFPADLAFARQATERASGVSLGSADQVPSVFVEF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcagcagtgaaacaccgatcaatggcaagtctccggtgcacctggcgctg
cgccgggttgcgatcgatacctaccgggaaaacgtcgcctacctgcaccgcgactgtgcc
gcctgccgcgccgaaggtttccaggcgctggccaaggtggagattcgcgtcaacggcaag
cgcattctggccagcctcaatctggtggacgacccggccatcgtcggctgtgacgagctc
ggtttgtccgaagatgccttcgcccagcttggcgccgaagccggcgtgccggcatcgatt
tcccaggctgaaccggcggcatccattcccgccctgcatcgcaagatcgccggcgaacgc
ctgcgccgcgaggactttctggcgatcatgcgcgacatcgccgagcatcgttattcaaag
atcgagctgaccgccttcgtggtcgcctgcaaccagggcgaactggaccgtgaggaggtg
ttcttcctcaccgacgcgatgattcaggtcggccgccgcctggactggcgcgagcaccct
gtggtcgacaagcactgcatcggcggcatccccggcaatcgcacgtcgatgctggtggtg
cccatcgtcgccgcccacggcatgctgtgcccgaagaccagctcgcgggcgatcacctca
ccggccggtaccgccgacaccatggaggtgctggccaacgtcgaactgccgttcgagcgc
ctctgcgagatggtccgcgaggaacgcggctgcctggcctggggcggcaccagcgagctg
tcgccggccgatgacgtgctgatcgccgtcgagcggccgctgtcgatcgactcgcccggg
cagatggtcgcttcgatcctgtcgaagaagattgccgccggctccactcacctgctgctg
gacattcccatcggcccgacggccaaggtgcgttcgatggccgaggcgcagcgcctgcgc
aagctcttcgaattcgtcgcctctcgcctgggcctgaccctggacgtggtgatcaccgat
ggccgccagccgatcggcaatggtatcggcccggtgctggaggcacgcgacgtgatgcag
gtgctgcagaacgatccggcggcgccgatcgacctgcgccagaaggcgctacgcctggcc
ggacgcatgctggagttcgaccccgacgtacgcggcggcgacggctatgccatcgcccgc
gacatcctcgattcgggccgggcgctgaagaaaatgcattcgatcatcgccgcccagggc
agcaagcccttcgatcacaaccatccaccactcgcccgcctcagcttcgacgtgctggcc
gagcgcagcgcggtggtcaccggcatcgacaacctgcagctggcacgcattgcgcggctg
gccggcgcacccaaggtgcagggtgccggcgtggacattctgcgcaagctcggcgaaccg
gtgcaggctggtgactgtctgtatcgcgtttacgcggattttcccgccgacctcgccttc
gcccgccaggccaccgagcgcgccagcggcgtcagcctcggcagtgccgaccaggttccc
agtgttttcgtggagttctga

DBGET integrated database retrieval system