KEGG   Pseudomonas stutzeri RCH2: Psest_3647Help
Entry
Psest_3647        CDS       T02391                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psh01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:psh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3807488..3808330)
Genome map
AA seq 280 aa AA seqDB search
MSVPTVLEKIIARKFEEVAQRSRQVGLGELEQRAAAADPVRGFAAALERRVRSKEPAVIA
EVKKASPSKGVIRDPFLPAEIAASYETGGAACLSVLTDIDFFQGADEYLQQARAACSLPV
IRKDFMIDPYQVIEARALGADCILLIVAALDDARMHELAAVAKQQGLDVLVEVHDATELE
RALRLETPLVGINNRNLHTFEVNLETTLDLLPRIPKDRLVVTESGIFNRADVELMEINQV
YAFLVGEAFMRAEQPGVELQRLFYPDRSRGRAAPVAADPE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgccgaccgttctggagaagatcatcgcccgcaagttcgaggaggttgcgcag
cgcagtcgccaggtcgggctgggtgagctggagcagcgtgccgcagctgccgatccggtg
cgtggcttcgctgccgcgcttgagcgccgggtgcgcagcaaggagcctgcggttatcgct
gaggtgaagaaggcatcgccgagcaaaggggtcattcgcgatcccttcctgcccgccgag
attgccgccagctacgagaccgggggcgctgcttgcctgtcggtgttgaccgacatcgat
ttctttcagggcgccgatgaatatctgcagcaggcgcgggcggcttgctcgctgccggtt
atccgcaaggatttcatgatcgacccgtatcaggtgatcgaagcgcgcgcgcttggcgcc
gactgcattctactgatcgtcgcggcactggacgatgcgcgtatgcacgagctggcagcg
gtggccaagcagcaggggctggacgtgctggtagaggtgcacgacgctaccgaactcgaa
cgtgcgctgcgtctggaaacgccgctggtgggcatcaacaaccgcaacctgcataccttc
gaggtcaatctggaaaccacgctggatctgctgccgcggattccaaaggatcgtctggtg
gtgaccgagagcgggatcttcaatcgtgccgatgtcgagctgatggaaataaaccaggtc
tacgcattcctggtgggcgaggcgttcatgcgcgccgagcaacctggcgtagagctgcag
cgcctgttctaccctgatcgttcgcgcggccgtgcggcccctgtcgctgccgatccggag
tga

DBGET integrated database retrieval system