KEGG   Pseudomonas stutzeri RCH2: Psest_3647Help
Entry
Psest_3647        CDS       T02391                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01130  Biosynthesis of antibiotics
psh01230  Biosynthesis of amino acids
Module
psh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psest_3647
Enzymes [BR:psh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Psest_3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FeoB_N
Motif
Other DBs
NCBI-ProteinID: AGA88125
UniProt: L0GRW2
Position
complement(3807488..3808330)
Genome map
AA seq 280 aa AA seqDB search
MSVPTVLEKIIARKFEEVAQRSRQVGLGELEQRAAAADPVRGFAAALERRVRSKEPAVIA
EVKKASPSKGVIRDPFLPAEIAASYETGGAACLSVLTDIDFFQGADEYLQQARAACSLPV
IRKDFMIDPYQVIEARALGADCILLIVAALDDARMHELAAVAKQQGLDVLVEVHDATELE
RALRLETPLVGINNRNLHTFEVNLETTLDLLPRIPKDRLVVTESGIFNRADVELMEINQV
YAFLVGEAFMRAEQPGVELQRLFYPDRSRGRAAPVAADPE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgccgaccgttctggagaagatcatcgcccgcaagttcgaggaggttgcgcag
cgcagtcgccaggtcgggctgggtgagctggagcagcgtgccgcagctgccgatccggtg
cgtggcttcgctgccgcgcttgagcgccgggtgcgcagcaaggagcctgcggttatcgct
gaggtgaagaaggcatcgccgagcaaaggggtcattcgcgatcccttcctgcccgccgag
attgccgccagctacgagaccgggggcgctgcttgcctgtcggtgttgaccgacatcgat
ttctttcagggcgccgatgaatatctgcagcaggcgcgggcggcttgctcgctgccggtt
atccgcaaggatttcatgatcgacccgtatcaggtgatcgaagcgcgcgcgcttggcgcc
gactgcattctactgatcgtcgcggcactggacgatgcgcgtatgcacgagctggcagcg
gtggccaagcagcaggggctggacgtgctggtagaggtgcacgacgctaccgaactcgaa
cgtgcgctgcgtctggaaacgccgctggtgggcatcaacaaccgcaacctgcataccttc
gaggtcaatctggaaaccacgctggatctgctgccgcggattccaaaggatcgtctggtg
gtgaccgagagcgggatcttcaatcgtgccgatgtcgagctgatggaaataaaccaggtc
tacgcattcctggtgggcgaggcgttcatgcgcgccgagcaacctggcgtagagctgcag
cgcctgttctaccctgatcgttcgcgcggccgtgcggcccctgtcgctgccgatccggag
tga

DBGET integrated database retrieval system