KEGG   Pseudomonas stutzeri RCH2: Psest_3653Help
Entry
Psest_3653        CDS       T02391                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Psest_3653
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psest_3653
   00310 Lysine degradation
    Psest_3653
Enzymes [BR:psh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Psest_3653
    2.6.1.48  5-aminovalerate transaminase
     Psest_3653
Amino acid related enzymes [BR:psh01007]
 Aminotransferase (transaminase)
  Class III
   Psest_3653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3813110..3814390)
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFADHAKNSSVVDVEGREFIDFAGGIAVLNTGHLH
PKIIKAVEDQLHKLTHTCFQVLAYEPYVELCEKINARVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVAPYSAGMGLMPGGIFRALYPCAIYGVS
VDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFNVAPKDFMARLRALCDEHGILLIAD
EVQTGAGRTGTFFAMEQMGVVADLTTFAKSVGGGFPIAGVCGKAEIMDAIAPGGLGGTYA
GNPLSCAAALAVLEVFEEEKLLDRCKAVAERLTTGLKAIQTKHKEIGEVRGLGAMIAIEL
FEDGDHARPAAALTSQIVARARDKGLILLSCGTYYNVLRVLVPLTAEDELLDRGLAIIGE
CFDELT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgatgcaacgccgtgtcgccgccgttccccgtggcgtc
ggccagatccatccgatatttgccgatcacgcgaagaacagcagcgtggtcgacgtcgaa
ggccgcgagttcatcgatttcgccggtggcatcgccgtgctgaataccggtcacctgcac
ccgaaaatcatcaaggcggtcgaggaccagctgcacaagctgacccacacctgcttccag
gtgctggcctacgagccctacgtcgagctgtgcgagaagatcaacgcgcgggtgccgggt
gatttcgccaagaagaccctgcttgtcactaccggctccgaggcggtggaaaacgcggtg
aagatcgcccgcgccgccaccgggcgtgccggcgtgatcgccttcaccggcgcctaccat
ggccgcaccatgatgaccctggggctgaccggcaaggtcgcgccgtactccgctggaatg
ggcctgatgcccggcggtatcttccgtgcgctgtacccctgcgccatttatggcgtcagc
gtcgatgactcgatcgccagcatcgagcgcatcttcaagaacgacgccgagccgcgcgat
atcgccgcaattatcatcgaaccggtgcagggcgagggcggcttcaacgtcgcgccgaag
gatttcatggctcgcctgcgcgcactgtgcgacgaacacggcatcctgctgatcgccgac
gaagtgcagaccggcgccgggcgtaccggcaccttcttcgccatggaacagatgggtgtg
gtcgccgacctgaccacctttgccaagtctgttggcggtggtttcccgattgccggcgtg
tgcggcaaagccgagatcatggatgccattgcgcccggcgggctgggcggcacctacgcc
ggcaatccgctgtcctgtgcagccgcgctggcggtgttggaagtcttcgaggaagagaag
ctgctcgaccgctgcaaggcggtagccgagaggctgaccacaggcctcaaggcaatccag
accaagcacaaggagatcggcgaggtgcgcggtttgggcgcgatgatcgcaatcgagctg
ttcgaggacggcgatcatgcgcggccggctgccgccctgacctcgcagatcgtcgcccgt
gcgcgggacaagggcctgatcctgctgtcctgcggcacctactacaacgtgcttcgtgtg
ctggtgccgctgactgccgaagacgaactgctcgaccgtggcctggccatcatcggtgag
tgcttcgatgagctgacctga

DBGET integrated database retrieval system