KEGG   Pseudomonas stutzeri RCH2: Psest_3747Help
Entry
Psest_3747        CDS       T02391                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00860  Porphyrin and chlorophyll metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
Module
psh_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psest_3747
Enzymes [BR:psh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Psest_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGA88223
UniProt: L0GN97
Position
complement(3918095..3918865)
Genome map
AA seq 256 aa AA seqDB search
MNDWRLLLTRPAEECGPVAASLAEDDIHTASLPLLAIEPLPETAEQRATILDLDRYCAVI
VVSKPAARLGIELLDRYWPQPPLGQAWFSVGAATGAILADYGLDTCWPERGDDSEALLAL
PRLDAALARPDPKVVILRGEGGRELLAETLRGRGVQVDILELYRRRLPAYPPGTLAATVR
SERLNGLVVSSGQGLLSLHELAADTWPELLELTLFVPSPRVAEMARQLGAKRIVDCRGAS
VAALLAALRETAVTAS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgactggcgtctgctgctgacccggccggccgaggagtgcggtccggtcgcggca
tcattggctgaagacgacattcacactgcgagcctgccgctgctggcgatcgagcctttg
ccggaaaccgccgagcagcgcgcgacgattctcgacctggatcgctactgcgcggtcatc
gtggtgagcaaaccggcggcgcggctgggcatcgagctgctcgaccgctattggccgcaa
ccaccgcttggccaggcctggttcagcgtcggtgctgccactggcgcgatactcgccgac
tacggtctggacacctgctggccggagcgcggcgacgacagcgaggcgctgctggcgctg
ccgcgcctcgacgcggcactggccagacctgatccgaaggtggtgatcctgcgtggtgag
ggtgggcgtgagttgctcgccgagacgttgcgcgggcgtggcgtgcaggtggatatcctc
gaactctaccggcgtaggcttcctgcttacccgccgggcacgctggccgctacggtccgt
tcggaacggctcaacggcctggtggtcagcagtgggcagggtttgctgtcgctgcatgag
ctggcggccgatacctggcctgaattgcttgagctaaccttgttcgtacccagtccgcgg
gtcgcggagatggctcggcagttgggcgccaaacgaattgtggattgccgtggcgcaagc
gttgcggcattgctggcggcgttgcgggaaaccgcagtgactgcctcctga

DBGET integrated database retrieval system