KEGG   Pseudomonas stutzeri RCH2: Psest_3806Help
Entry
Psest_3806        CDS       T02391                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psest_3806
   00030 Pentose phosphate pathway
    Psest_3806
   00051 Fructose and mannose metabolism
    Psest_3806
   00052 Galactose metabolism
    Psest_3806
   00500 Starch and sucrose metabolism
    Psest_3806
   00520 Amino sugar and nucleotide sugar metabolism
    Psest_3806
  Nucleotide metabolism
   00230 Purine metabolism
    Psest_3806
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psest_3806
Enzymes [BR:psh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Psest_3806
    5.4.2.8  phosphomannomutase
     Psest_3806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3975811..3978384
Genome map
AA seq 857 aa AA seqDB search
MALFKRTAKDSGVLNPASTRTKPAGVTIKPLLGGLASGLIGLGAAAALLWLGLQNAQQQQ
QAQLSQAWGQSQAGALQQALRQQRAETQALVDRQQLADVLRGDAERRRDAEERLLQLPGV
VDAHLNIRGRAVPDTNRPGPLNFAALDLLQRVEAGQSPAPEAYKVDNRWLLYSAVPLRAE
GQQAIRGTLLLVSDLERLFATLPALPAEAGQLRLTQQFSGTQEQLLLQRGAPAEGATAVT
LSSGNANWKLVYLPGSEAAQATLSPLLLIGAALLALAGMLIGLQLVLGSQQRKLREDVMQ
ISRLLQELSTGKTIQVPALSLPVLDALARNMVRLPVRPAGPAPTQAPAAAPAVRPAKPTE
YVDPRLPETDILDIDILDEDQDIFGLDTKERETAMSSAKAPNLPASIFRAYDIRGVVGDS
LTTETAYWVGRAIGSESLAKGEPNVSVGRDGRLSGPELVQHLIQGLLDSGCDVSDIGMVP
TPVLYYAANILAGKSGVMLTGSHNPPDYNGFKIVIAGDTLANEQIQTLRKRIENNDLSSG
VGKVEQVDVLERYFQQIRSDIAMAKPMKVVVDCGNGVAGVIAPRMIEALGCTVIPLYCDV
DGNFPNHHPDPGKPENLVDLIAKVKSEKADLGLAFDGDGDRVGVVTNAGTMIYADRLLML
FAKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKESGALLAGEM
SGHIFFKERWFGFDDGIYSAARLLEILSQDKRDAEQVFAAFPCDISTPEINITVTEESKF
TIMDALQRDAQWGEANLITLDGVRVDYPKGWGLIRASNTTPVLVLRFEADSEEELSRIQD
VFRAQLLNVAPDLKLPF
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggcactcttcaagcgcaccgccaaggattcaggcgtactgaacccggccagtacccgt
accaagcccgccggcgtcaccatcaaaccactgctaggcggccttgccagcggcctgatc
ggcctgggcgcagccgcggcgctactgtggctgggcctgcaaaacgcgcaacagcaacaa
caggcgcaactttcccaagcctggggccagagccaggccggtgcgctgcagcaggcactg
cggcaacagcgggccgagactcaggccttggtggaccgccagcaactggccgatgtgctg
cgcggcgatgccgagcgccgacgcgatgccgaagagcgtctgctgcagctgcccggcgtt
gtcgatgcccacctgaacatacgaggcagagccgtaccggataccaatcgcccggggccg
cttaacttcgcagcgctcgacctgctacaacgcgtcgaagccggccagtcaccggcgccg
gaagcctacaaggtcgacaaccgctggctgctgtacagcgccgtgccgctgcgtgcggag
ggtcagcaagcgatacgcggcaccctgctgctggtcagcgacctcgagcgtcttttcgcg
acgctgccggcgctgcccgccgaggctggccagttgcgcctgactcagcagttttccggc
acacaggaacagttgctgctgcaacgcggcgcgccggcggagggtgccacagcagtgacc
ctttccagcggcaacgccaactggaaactggtctacctccccggcagcgaagccgcgcag
gcgacgctctcaccgctgttgctgattggagccgcgctgctggcactcgccggcatgctc
atcggcctgcaactggtgcttggcagtcagcaacgcaagctgcgcgaagacgtaatgcag
atcagccgcctgttgcaggaactctctaccggcaagaccatccaagtaccggccttgagc
ctgccggtcctcgacgcactggccaggaacatggtccgactgcccgtccgccccgccgga
ccggctccgacccaggcacccgccgcggctcccgccgttcggcccgccaaacctaccgag
tacgtcgatccgcgcttgccggagaccgatattctcgacatcgatattctcgacgaggac
caggacatttttggcctcgacaccaaggagcgagaaaccgcaatgagcagcgccaaagcc
ccgaacttgccagccagtatcttccgcgcctatgacatccgcggcgtcgtcggcgacagc
ctgaccaccgaaaccgcctactgggtcggccgcgccatcgggtccgaaagcctcgccaag
ggtgaacccaatgtgtcggttggccgcgacggacggctgtccggtcccgaactggtccag
caccttatccagggcctgctcgacagcggctgcgacgtcagcgatatcggcatggtgccg
actccggtgctctattacgcagcgaacatcctcgccggcaagtccggtgtgatgcttacc
ggcagccacaacccgccggattacaacggtttcaagatcgtcatcgccggcgacaccctg
gccaacgaacagatccagaccctgcgcaaacgcatcgagaacaacgatctctccagcggt
gtcggcaaggtcgagcaggtcgacgtgcttgaacgctacttccagcagattcgcagcgac
atcgccatggccaagccgatgaaggtggtggtcgactgcggcaacggcgtcgctggcgtc
atcgccccgcgcatgatcgaggcgctgggctgcaccgtgatcccgctgtactgcgatgtc
gacggcaacttccccaaccaccatccggacccgggcaagcccgagaacctggtcgatctg
atcgccaaggtgaagtcggagaaggccgatctaggtctggctttcgacggcgatggcgac
cgcgtaggggtggtgaccaacgccggcaccatgatctatgccgaccgcctgctgatgctg
ttcgccaaggacgtcgtttcacgcaatcccggcgccgacatcatcttcgacgtcaaatgc
acccgccgcctgaccccgctgatcagcggctacggcggtcgcccggtgatgtggaaaacc
ggtcactcgctgatcaagaagaagatgaaggaatccggcgcgctgctggctggcgaaatg
agcggccatatcttcttcaaggagcgctggttcggcttcgacgatggcatctacagtgcc
gcgcgcctgctggagatcctcagccaggacaagcgtgacgccgagcaggtgttcgctgcg
ttcccctgcgatatctcgacaccggagatcaacatcacggtgacagaggaaagcaaattc
accatcatggacgccctgcaacgcgacgctcagtggggcgaagccaacctgatcaccctc
gacggtgtgcgggtcgactatcccaagggctggggcctgattcgcgcatcgaacaccaca
ccggtcctggtgttgcgcttcgaggccgacagcgaggaagaactcagccgtattcaggat
gttttccgcgcacagctgctcaacgttgcacccgacctcaaactgccgttctga

DBGET integrated database retrieval system