KEGG   Pseudomonas stutzeri RCH2: Psest_3837Help
Entry
Psest_3837        CDS       T02391                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00620  Pyruvate metabolism
psh00630  Glyoxylate and dicarboxylate metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psest_3837
   00630 Glyoxylate and dicarboxylate metabolism
    Psest_3837
Enzymes [BR:psh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psest_3837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AGA88312
UniProt: L0GR88
Position
complement(4007300..4009480)
Genome map
AA seq 726 aa AA seqDB search
MTERVTLGRLQVAANLQRFIEDEVLPGSGIEAAAFWQGLDALVHDLAPKNRELLAERDRM
QVELDTWHKANPGPIKDMAAYRAFLESIGYLLPVPGEVKIETANVDSEIATQAGPQLVVP
IMNARYALNAANARWGSLYDALYGTDAISEEGGAQKGPGYNEVRGAKVIAYARNFLDQAA
PLAEGSHADATAYRVQDGQLKVTLENGSVTGLAQPEKFVGFQGEAVEPKAVLLKNNGLHV
EIQIDPNSPIGQTDAAGVKDLLVESAVSTILDCEDSVAAVDADDKVLAYRNWLGIVQGTL
SEEVAKGSSSFVRRLNPDREYSAPNGGELKLHGRSLLFIRNVGHLMTNPAILLEDGREIP
EGIMDGVFTSLIAKHDLQRKGNSRTGSVYIVKPKMHGPKEVAFADELFGRVEELIGVPRY
TLKMGIMDEERRTSANLKACIAAAKHRVAFINTGFLDRTGDEMHTCMEAGPVLRKGDMKS
TPWIQSYERNNVLVGLACGLRGKAQIGKGMWAMPDLMAAMLEQKIGHPKSGANTAWVPSP
TGATLHALHYHQVNVQAVQSELEKIDLAAERDQLLNDLLSIPVVAEDKWSAEEKQQELDN
NCQGILGYVVRWVEQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLHHGVVSREQVQE
TLQRMAKVVDQQNAGDPLYRAMSSDYTQSIAFQAASDLVFKGREQPAGYTEPLLHAWRQR
YKASQA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgtaaccctgggccgcctgcaagtcgcggccaatctgcagcgtttcatc
gaagacgaagtcctgccgggcagcggtatcgaagccgccgccttctggcagggcctggac
gccctggtccatgacctggcgccgaagaaccgtgaactgctcgccgagcgcgaccgcatg
caggtcgagctggacacatggcacaaagccaatcccggtccgatcaaggacatggccgcc
taccgcgccttcctcgaatccatcggctacctgctgccggtgcccggcgaggtgaagatc
gaaaccgccaacgtcgacagcgagatcgccacccaggccggcccgcagctggtggtgccg
atcatgaacgcgcgttatgcgctgaacgccgcgaacgcccgctggggctcgctgtacgac
gcgctctacggcaccgacgccatctccgaagagggcggcgcgcagaagggcccgggctac
aacgaagtccgtggcgccaaggtcatcgcctacgcgcgcaatttcctcgatcaggccgcg
ccgctggccgaaggcagccacgccgacgccaccgcctatcgcgtgcaggatggccagctg
aaggtcaccctggagaacggcagcgtcaccgggctggcgcagccggaaaaattcgtcggc
ttccagggtgaagcggtcgagccgaaggccgtgctgctgaagaacaacggcctgcacgtc
gagatccagatcgatccgaacagcccgatcggccagaccgatgctgctggcgttaaggac
ctgctggtcgagtccgcggtttccaccatcctcgactgcgaagactcggttgctgcggtg
gatgccgatgacaaggtgctggcctaccgcaactggctgggcatcgtgcagggcaccctc
agcgaggaagtcgccaagggcagctcgagcttcgtccgccgcctgaacccggaccgcgaa
tacagcgcacccaacggcggcgagctgaagctgcatggtcgttcgctgctgttcatccgc
aacgtcggtcacctgatgaccaacccggcgatcctgctggaagacggccgcgagattccg
gaaggcatcatggacggtgtgttcaccagcctgatcgccaagcacgacctccagcgcaag
ggcaactcgcgcaccggcagcgtctacatcgtcaagccgaagatgcacggaccgaaggaa
gtcgccttcgccgatgagctgttcggtcgcgtcgaggagctgatcggtgtgccgcgctac
accctgaagatgggcatcatggacgaggagcgccgcaccagcgccaacctcaaggcctgc
atcgctgcggccaagcaccgcgtggccttcatcaacaccggcttcctcgaccgtaccggc
gacgagatgcacacctgcatggaagccggcccggtgctgcgcaagggtgacatgaagtcc
accccgtggatccagtcctacgagcgcaacaacgtgctggtcggcctggcctgcggcctg
cgcggcaaggcgcagatcggcaagggcatgtgggccatgccggacctgatggcagccatg
ctcgagcagaagatcggccatccgaaatccggcgccaacaccgcctgggtgccgtcgccg
accggcgccaccctgcacgcgctgcactaccaccaggtgaacgtgcaggccgtgcagagc
gagctggagaagatcgacctggcggccgagcgcgatcagctgctcaacgacctgctgagc
atcccggtggtcgccgaagacaagtggagcgccgaagagaagcagcaggagctggacaac
aactgccagggcatcctcggctacgtggtgcgctgggtcgagcagggcgtcggctgctcc
aaggtaccggacatccacaacgtcggcctgatggaagaccgcgccaccctgcgtatctcc
agccagcacattgccaactggctgcaccacggtgtggtcagccgcgagcaggtgcaggaa
accctgcagcgcatggccaaggtggtcgaccagcagaacgctggcgatccgctctatcgc
gccatgtccagcgactacactcagtcgatcgccttccaggcggcgtcggatctggtgttc
aagggccgcgagcagccggcgggctacaccgagccgctgctgcatgcctggcgtcagcgc
tacaaggccagccaggcctga

DBGET integrated database retrieval system