KEGG   Providencia stuartii MRSN 2154: S70_00440Help
Entry
S70_00440         CDS       T02042                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    S70_00440
Enzymes [BR:psi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     S70_00440
Exosome [BR:psi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S70_00440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77190..78173
Genome map
AA seq 327 aa AA seqDB search
MNNLHSIQRMRRLRKTEKMRDLFQETHLSLNDLCLPIFVEEGLDDYKQIDSMPGVVRIPE
KRLAYEIERIAKAGIKSVMTFGVSHHLDETGSDAWQENGLVARMSRICKETVPEMIVMSD
TCFCEYTSHGHCGVMHGDIVDNDATIHNLGLQAVAAARAGADFIAPSAAMDGQVAAIRQA
LDAAGFKDTAIMSYSTKFASALYGPFRDAAGSCLKGDRKTYQMNPMNRREAIHESLIDVQ
EGADALMVKPAGAYLDIIRDLRERTELPIGAYQVSGEYAQIKFAAMAGAIDETRVTLETL
GSIKRAGADMIFTYFALQLAEDKILSR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaataacctgcattctatccaacgcatgagaagattacgtaagactgaaaaaatgcgt
gatctcttccaagaaacgcatctttctcttaatgacctgtgccttccaatctttgttgag
gaagggcttgatgattataagcaaattgacagcatgccaggtgttgtacgtattccagaa
aaacgtttagcttatgaaatagagcgtattgccaaagcaggtattaaatctgttatgact
tttggcgtctctcatcatttggatgaaacagggagtgatgcttggcaagaaaatggcctt
gtcgcacgtatgtctcgtatctgtaaagagacagtacctgaaatgattgtgatgtcggat
acctgtttttgtgaatacacttcacacggccattgtggggtaatgcatggcgatatcgtt
gataacgatgccactatccataatttaggtttacaagctgttgcagccgcccgtgcaggt
gctgattttatcgccccttctgctgcaatggatgggcaagttgccgctatccgccaagct
ctagatgcagctggttttaaagataccgccattatgtcttattcgactaaatttgcgtca
gcactctatggcccatttagagacgcggcaggctcttgtttaaaaggggatcgcaaaacc
tatcaaatgaatccaatgaaccgccgtgaggcaattcatgaatccttaattgacgtacaa
gaaggcgcggatgcattgatggttaaaccagcaggtgcctaccttgatattattcgtgac
ctacgtgaacgtactgaattgcctatcggtgcttatcaagtcagtggtgaatatgcacaa
attaaatttgctgcaatggctggggctatcgatgaaacccgcgtcactctggaaacatta
ggctctatcaaacgggctggcgctgatatgattttcacctattttgccctgcaattagcc
gaagataaaattttgtcacgataa

DBGET integrated database retrieval system