KEGG   Providencia stuartii MRSN 2154: S70_00540Help
Entry
S70_00540         CDS       T02042                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S70_00540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S70_00540
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S70_00540
Enzymes [BR:psi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     S70_00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101215..102405
Genome map
AA seq 396 aa AA seqDB search
MSKLDPYFGEFGGQYVPEILIPALNQLEDAFIEAQNDPTFIKEFHDLLKNYAGRPTALTL
CRNLTEGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALLNMKCRIYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSGSY
DKAHYLLGTAAGPHPYPTIVRDFQRMIGDEAKQQVLEKEGRLPDAVIACIGGGSNAIGLF
ASFIPEENVRLIGVEPAGLGIETGQHGAPLKHGRVGIYFGMKSPMMQTDEGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRADYVSITDDEALAAFKLLSRKEGIIPALESSHALAYALKL
AEKEPNKEQLLIVNLSGRGDKDIFTVHDILKSKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattagacccctactttggtgaattcggtggacaatatgttcctgagatttta
attccagcccttaaccaactggaagatgcctttattgaggctcaaaacgatccgacattt
attaaagaattccatgatctccttaaaaattatgccggtcgccctactgcattaacactc
tgtaggaatttaaccgaaggcactaaaacgaaactatatctaaaacgtgaagatctactt
catggtggcgcacataaaactaaccaagtattaggccaagcattattagctaagcgaatg
ggtaaaacagaaattattgctgaaacgggtgcaggtcaacatggcgtcgcaaccgctcta
gcgtgtgctttgcttaatatgaagtgccgtatttatatgggggcaaaagatgttgagcgc
caatcacccaatgttttccgtatgaagctaatgggtgcggaagtgatccctgtacacagt
ggctcagccaccttaaaagatgcttgtaatgaagcgcttagagattggtctggcagttat
gataaggcgcattacttgctaggaacagcggcaggcccacatccatatccaaccattgtc
cgtgattttcagcgtatgattggcgatgaagcaaaacaacaggtactcgaaaaagaagga
aggctgcctgacgccgtgatcgcttgtattggtggcggctcaaatgcaattggcctcttt
gcatcatttattcctgaagaaaatgtgcgccttatcggtgtggaacctgcgggtttgggt
atcgaaacaggccaacacggtgcaccactcaagcatggtcgcgtcggcatctactttggt
atgaagtcaccgatgatgcaaacggatgaagggcaaattgaagagtcctactctatttcc
gctgggcttgatttcccatctgttggaccacagcatgcacatttaaacagtattgggcga
gcggattatgtttccattaccgatgatgaagccttagcggcctttaaattgctatcacgt
aaggaaggtatcatccctgcattagaatcatcacatgcattagcgtatgcactaaaactc
gcggaaaaagagccaaataaagaacaattactgattgtgaacctttctggccgtggcgat
aaagatatttttaccgtacatgatattttaaaaagtaagggagaaatctaa

DBGET integrated database retrieval system