KEGG   Providencia stuartii MRSN 2154: S70_00545Help
Entry
S70_00545         CDS       T02042                                 

Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S70_00545
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S70_00545
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S70_00545
Enzymes [BR:psi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     S70_00545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
102405..103211
Genome map
AA seq 268 aa AA seqDB search
MERYTQLFERLNRVNQGAFVPFVTLGDPDAELSLKIVDALIAGGADALEIGIPFSDPLAD
GPTIQNANLRAFKSDITPTLCFELLARIRQKHPDMPIGLLVYANLVFSNGIDNFYSRCQQ
AGVDSVLVADVPMRESKPFRESALAHGIAPIFICPPNADEPLLKQIGEYSQGYTYLLSRA
GVTGTEKRAETPLTNLISRLNEYQAAPPLQGFGISEPSQVSEAIANGAAGAISGSAVVKI
IENNLHRPDIMLAELTQFVAKMKAATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttatactcaactttttgaacgcttgaaccgcgttaaccaaggtgctttcgtt
ccgttcgtaacattaggcgatcctgacgctgagctatccttaaaaattgtagatgcccta
attgctggtggcgctgatgcattagaaattggtattcctttctccgatcctctcgctgat
ggtcctactatccaaaatgcgaatttaagggcgtttaaaagtgatattaccccaacattg
tgctttgaacttttggctcggataaggcagaaacaccctgatatgcccattggcttactt
gtctatgccaatttggtctttagtaatggtatcgataacttttattcacgttgtcaacaa
gctggtgtcgattcagtattggtcgcagatgttcctatgcgtgagtcaaagccctttcgc
gagtctgccttagcacatggtattgcgcctatttttatttgcccgccaaatgctgatgag
ccattactcaagcaaattggtgaatatagccagggctatacttacttattatcaagagca
ggagtgacaggaacagaaaaacgtgctgagacaccattgactaacttaattagtcggtta
aatgagtatcaggcagcaccaccactacaaggatttggtatttctgaaccatctcaagtt
agcgaggcaatcgctaatggcgcagctggtgccatttcaggctctgccgtggttaaaatt
atcgaaaataatcttcatcgccctgatattatgctggcagaacttacccagttcgtggca
aaaatgaaggcagcaacacaaaaatag

DBGET integrated database retrieval system