KEGG   Providencia stuartii MRSN 2154: S70_00650Help
Entry
S70_00650         CDS       T02042                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    S70_00650
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_00650
   00620 Pyruvate metabolism
    S70_00650
   00650 Butanoate metabolism
    S70_00650
  Lipid metabolism
   00071 Fatty acid degradation
    S70_00650
  Amino acid metabolism
   00350 Tyrosine metabolism
    S70_00650
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    S70_00650
   00626 Naphthalene degradation
    S70_00650
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     S70_00650
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     S70_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121903..124563
Genome map
AA seq 886 aa AA seqDB search
MSVTNVTELNDLVARVKKAQREFANFSQEQVDRIFRAAALAAADARIPLAKLAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDPTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKNATNKAAEIVLKAAIEAGAPKDIIGWIDAPSVELSNA
LMHHEDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVVVVDEIYNQVRERFATHGGYILQGKELKAVQDVILKNGSLNAAIVGQT
AYKIAEMAGVTVPVTTKILIGEVKVIADSEPFAHEKLSPLLAMYRAKNFEEAVDKAEQLV
EMGGIGHTSCLYTDQDNQAERVNYFGVKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMLWHKLPNSIYFRRGCLPIALEEIATDGAK
RAFIVTDGYLFNNGYVEEVVNVLKKHHIETDVFFEVEADPTLTVVRKGAAQMNAFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIHRFPKMGVKAKLVAITTTSG
TGSEVTPFAVVTDDKTGQKYPLADYALTPNMAIVDANLVMNMPKSLTAFGGLDAVTHAME
AYVSVLANEYSDGQALQALSLLKEYLPTSYHEGATNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLTKSSDRTDAKIEKLLAWLEEIKADLGIPKSIREAGVPEADFLARVDKLSEDAFDDQ
CTGANPRYPLISELKQLLLDSYYGREFTEQTSTTTAAKVEKKSSKK
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaactaatgttaccgaactcaatgacctcgttgctcgtgtcaaaaaagctcag
cgtgaattcgctaacttctctcaagagcaagttgaccgcattttccgcgcagcagcgctt
gcagcagcagacgcacggatcccgctcgctaaacttgctgtagaagaatcaggtatgggt
attgttgaagataaggtgatcaaaaatcactttgcctctgaatatatttataatgcctat
aaagacgaaaaaacctgtggcgtgctttctgaagacccaacttttggaacaattactatc
gctgaacctatcggtattatctgtggtatcgttccaaccactaacccaacctcaactgcc
atttttaaatctttaattagtttaaaaacgcgtaatgcaattattttttctccgcaccct
cgcgctaaaaatgcaaccaataaagcggcagaaattgttcttaaagcagctatcgaagct
ggtgcaccgaaagatattatcggttggatcgatgcaccatcggtcgaattatctaatgca
ttgatgcatcacgaggatatcaacctgattttagcaacaggtggtcctggtatggtgaaa
gcggcatacagctccggtaaacctgctattggtgtaggcgcaggtaatacaccggttgtt
atcgatgaaacggccgatatcaaacgtgctgtggcgtctatcttgatgtcaaaaaccttc
gataatggcgtcatctgtgcatccgagcaatccgttgttgtcgttgatgaaatttataat
caggttcgtgaacgcttcgcgacccacggtggctatatactgcaaggtaaagagcttaaa
gccgttcaagatgttatcttgaaaaatggtagtctgaacgcagcaattgttggtcaaact
gcatataaaatcgctgaaatggccggtgttactgtacctgtaaccacgaaaatacttatt
ggcgaagtcaaggtaattgcagattcagagccatttgcccacgaaaaattatcgccactc
cttgccatgtatcgcgctaaaaactttgaagaggctgtagacaaagccgagcaattagtc
gaaatggggggtatcggtcacacctcttgtctatatacagaccaagataaccaagctgaa
cgtgttaattacttcggcgtcaaaatgaaaaccgcgcgtatcctcattaatacgcccgct
tcacaagggggtatcggtgacctctataactttaaattagcgccttctctcacacttggt
tgcggttcatggggtggtaactcaatctctgaaaacgttggaccaaaacatttgatcaat
actaaaaccgtggcgaaaagagctgaaaatatgttgtggcataaacttcctaactcaatc
tatttccgtcgcggttgtctccctattgcacttgaagagatcgcaacggatggcgcaaaa
cgtgcatttatcgtcactgatggctatttatttaacaatggctatgttgaagaagtggta
aatgtactgaaaaaacaccatattgaaaccgacgttttctttgaggttgaagctgatcct
acattaacggtcgtccgtaaaggtgccgctcaaatgaacgcctttaaacctgatgtcatt
attgcattaggtggtggctccccaatggacgcggccaaaattatgtgggttatgtacgaa
catccagaaacgcattttgaagaattagcactacgctttatggatatccgtaaacgtatt
caccgtttccctaaaatgggagtgaaagcaaaattagttgcgattacaacgacctcagga
acaggctctgaagttaccccatttgcagtggtaacggatgataaaacaggtcaaaaatac
ccattagcggactatgcactgactccaaatatggctatcgtcgatgcaaaccttgtgatg
aatatgccgaaatcactgaccgcatttggtggtctggatgctgtgactcatgcgatggaa
gcctatgtttctgtattagcgaatgaatactctgatggtcaagcattacaagcgcttagc
ctattaaaagagtacctaccgacgagttatcatgaaggggcaaccaatcctgttgcaaga
gagcgtgtccataacgctgcaaccatcgctgggattgcatttgcaaacgcattcttaggg
gtttgtcactcaatggcccataaattaggctctgagttccacataccacatggattagcg
aatgccttattaattagtaacgtcgttcgttataatgctaacgataacccaactaaacaa
acggcatttagccaatatgaccgtccacaagcacgacgccgttatgctgaaatagccgac
catttaggtttaacaaaatctagcgaccgtaccgatgctaaaattgaaaaactattagca
tggcttgaggaaatcaaagcagatttaggtatccctaaatccatacgtgaagcaggtgtg
cctgaagcagacttcttagcacgcgttgataagctctctgaggatgcatttgacgaccaa
tgtaccggtgcaaaccctcgctatccattaatttctgaattgaaacagctattactggat
tcctattatggacgcgaattcactgaacaaacatccacaacaacagcagcaaaagtggaa
aagaaaagttcaaaaaaatag

DBGET integrated database retrieval system