KEGG   Providencia stuartii MRSN 2154: S70_00665Help
Entry
S70_00665         CDS       T02042                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    S70_00665
   00052 Galactose metabolism
    S70_00665
   00500 Starch and sucrose metabolism
    S70_00665
   00520 Amino sugar and nucleotide sugar metabolism
    S70_00665
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     S70_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(126752..127690)
Genome map
AA seq 312 aa AA seqDB search
MTKMTNRKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVL
VTHSSKNSIENHFDTSFELEAILEARVKRQLLDEVQSICPSHVTIMQTRQGIAKGLGHAI
LCAKPLVGNEPFAVILPDVILDRYSTDLTKFNLSEMLAHFEETGASQILVEPVPEDEVSN
YGIVDCNGATLLPGESKPISRMVEKPKKEEAPSNLSIVGRYVLSEKIWDALAKTAPGAGD
EIQLTDAIAIMMENKSPVEAYHLCGKSHDCGNKLGYMKAFVEYGMQHDSLGEDFSEWIQT
ISNKLNSSKAEK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatgacaaatagaaaggtacgcaaggcagtaatccctgtcgcaggtcttggc
actcgtatgttacccgcgactaaagcaattcccaaagagatgttaccactcgttgataaa
cctttaattcagtatgttgttaatgagtgtatcgctgctggtattaatgaaattgtttta
gtgactcattcatcaaaaaactcgattgaaaaccacttcgatacgagtttcgagcttgag
gcaattttagaagctcgtgttaagcgtcaattactcgatgaagtgcaatctatctgccca
agtcacgtaactatcatgcaaacgcgtcaaggtattgctaaaggcttaggtcatgcgatt
ttatgtgctaagcctcttgtggggaatgagccttttgcggttattctgcccgatgttatt
ttagatcgttatagcaccgatttaaccaagtttaatttgagcgaaatgctggcccatttt
gaagaaacgggagcaagccaaattttggttgagcccgttcctgaagatgaagtttctaat
tatgggattgtagattgtaatggtgcaacgttgcttcctggtgaaagcaaaccgattagc
cgcatggtagaaaaaccgaagaaagaagaagcaccatcaaatctgtcgattgttggccgc
tatgtattatcggaaaaaatttgggatgcactagcaaaaacagcaccaggggcaggggat
gaaattcaattaaccgatgctattgcgattatgatggaaaataagtctcctgtagaggcg
taccatctatgtggtaaaagtcatgactgtggtaataagctaggttatatgaaagcattc
gtagaatatggtatgcaacatgattcattaggggaagatttttctgagtggatccaaacc
atatcgaataaattgaacagttctaaagcagaaaaataa

DBGET integrated database retrieval system