KEGG   Providencia stuartii MRSN 2154: S70_00745Help
Entry
S70_00745         CDS       T02042                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00010  Glycolysis / Gluconeogenesis
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_00745
Enzymes [BR:psi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     S70_00745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFH92049
UniProt: A0A140NF02
Position
143148..144029
Genome map
AA seq 293 aa AA seqDB search
MHDKLFALPVIKQLSAYISQRQLGELPLIIVSHPKVRGAVSIQGAQLIDWQPCGQKPCIW
LSSESAFKAGTAIRGGIPICWPWFGPAGSPSHGFARILPWQFTAHNEHEDGVILTFTLTD
NEYTRKLWPHEFTLILRMKLGETCELELESYGDFETTAAMHTYLNIGDIQKTTVYGLGGH
YFDKVSDREVYEDKPLKINSHTDRIYSEPEEYSLIRDDSWSRTIEIHHYHNSDVVCWNPW
AELSCSMQDMPNNGYKQMVCVETARINQPMKSENQHPARLSLVMMTRDNKPQD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcacgataaactctttgctttaccggtgattaagcaactttcagcctacattagccaa
cgccaattgggtgaattacccttaattattgtttcgcatcctaaagtgcgtggtgccgtt
agtattcaaggtgcacaattaatcgattggcaaccttgtggtcaaaaaccgtgcatctgg
ctaagcagtgaaagtgctttcaaagcaggtacagccattcgtgggggtatccctatttgc
tggccttggtttggccccgcaggtagcccaagtcatggtttcgcccgcattttaccgtgg
caatttactgcacataatgaacatgaagatggcgtgatcctcaccttcactctgacagat
aacgaatatacacgcaaactatggccacatgagtttacattgatattgcgaatgaaactc
ggtgagacctgtgagttagaattagaaagctatggtgattttgaaaccacagccgcaatg
cacacttacctcaatattggtgatatccaaaaaaccacggtatacggtttaggtggccac
tactttgataaagtcagtgaccgtgaagtttatgaagataagccgctaaaaattaatagc
cataccgacagaatttactctgagccagaggaatatagtttgatccgtgatgatagctgg
tcacgaaccattgaaatacaccattaccataactctgacgttgtatgttggaacccatgg
gctgaattgtcatgtagcatgcaagatatgccaaacaatggctacaaacagatggtttgt
gttgaaacggcgcgcattaatcaaccgatgaaaagtgaaaatcagcaccccgctcgcctt
tctctcgttatgatgacacgcgataataagccacaagactga

DBGET integrated database retrieval system