KEGG   Providencia stuartii MRSN 2154: S70_02050Help
Entry
S70_02050         CDS       T02042                                 

Definition
cellobiohydrolase A (1,4-beta-cellobiosidase A)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S70_02050
Enzymes [BR:psi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     S70_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
411093..412046
Genome map
AA seq 317 aa AA seqDB search
MYKILFLSLITACYTGNLMATEYFVDPTSSAALWVEKNKSDPRALAIRAKIASVPTAIWL
SKIHENETELAQQITSYISQADKQKTQLMFVLYALPNRDCSGQASASNTTNSQKYRTWIN
QLTKTISNTKLTIILEPDALADMSCLTPLQRKDRTDLLKYAVTQFKIKSPNAHVYLDAGN
MKWQPAKTMAEQLIAAGIKDASGFSLNISNYYATEPTIKYGEDINRFLMALIGIKSNMII
DTSRNGHGAPALPNQWCNPLGRKIGEGPKDISATVKTAWIKPPGESDGDFSPTANCHGGP
KAGVFSPDLAIRLIKGE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatacttttcttaagcttaattacagcttgctataccggaaacctaatggca
actgagtatttcgttgatcccacctcgtctgccgcattgtgggtagaaaaaaacaagagc
gatcccagagcactggctattcgggctaaaatagcgtctgtgcctacggctatttggctt
tctaaaatccatgaaaatgagactgaattagcccagcaaataacaagttatatttcacaa
gctgataagcaaaaaactcagcttatgtttgtgttatacgctctacctaaccgcgattgc
tcaggccaagcctccgccagcaacactactaatagccaaaaatatcgaacatggattaat
caattaacaaaaacaatttcaaacactaagcttaccattattttagagcctgacgcctta
gcggatatgagttgcctaacgccattgcagcgcaaagatagaacagatttactcaaatat
gctgtgactcaatttaaaataaaaagtcctaatgcgcatgtataccttgatgctggcaat
atgaagtggcaacccgcaaaaacaatggcagaacaacttattgcagcgggaataaaagat
gcctcaggtttttcactcaatatttctaattactatgcgaccgagcccactataaaatat
ggtgaagacattaatcgatttttaatggcgctgatagggataaaatccaatatgattatt
gatacctcacgcaatggtcatggtgcaccagcattgccaaatcaatggtgcaatccactt
ggccgtaagataggtgaaggcccaaaagatatttcagcaaccgttaaaaccgcttggata
aagccaccgggggaatcagatggcgacttttctccaacagctaattgccatggcggccct
aaagcaggggtttttagccctgatttagcgatacgcctgattaaaggggaataa

DBGET integrated database retrieval system