KEGG   Providencia stuartii MRSN 2154: S70_03460Help
Entry
S70_03460         CDS       T02042                                 

Gene name
galM
Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00010  Glycolysis / Gluconeogenesis
psi00052  Galactose metabolism
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
Module
psi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_03460 (galM)
   00052 Galactose metabolism
    S70_03460 (galM)
Enzymes [BR:psi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     S70_03460 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFH92575
UniProt: A0A140NHH3
Position
complement(717154..718194)
Genome map
AA seq 346 aa AA seqDB search
MQLSKDQGYVARASKVIALTNRHGMKILLSTLGASWISCILPMSAGKRDVLLGSPNMAAQ
MDQGVYLGATIGRVANRIAHGRFNLAGREYQVTSNQGEHCLHGGRDNFSYRVWKVTQINP
YEAIFSLVSEDGDQGFPGELQAEVRYILTDENKVIIDYRTQVSELCPVNLTNHAYFNLAG
EDSARTALEHDLQLAATHYLPTDKGGIPTGEWRDVSETFFDFRRKKRIGYDFLQDDDQKA
VGGYDHAMILAPELTDGEQTVASLFSPEGDVRMDIATTLPAMQVYTGNYLISVPGKSRHY
TPFSGVAFETQFPPDAVNHPEWGEQYSGISQPNQIYHQKTSYHFIF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagttatcgaaagaccaagggtatgtggcacgtgcatctaaagtgattgcattgacc
aacagacatggcatgaaaattttattgtcaaccttgggagcaagttggataagctgcata
ttacccatgtcggcaggtaaacgtgatgttttactcggttcaccgaatatggcggcccaa
atggatcaaggcgtttatctaggtgcaaccattgggcgagttgcgaaccggattgcacat
ggccgttttaatttagcgggtcgtgagtatcaggtgacaagtaatcaaggtgaacactgt
ttacatggcggtcgggataattttagttatcgtgtttggaaggtgactcaaattaaccca
tatgaggcaattttttcgttggtttcagaagatggcgatcagggatttcctggggaatta
caagctgaagtccgctatatattaacggatgaaaataaagtcattatcgactatcgtaca
caagtgagtgagttgtgccctgtaaatttaaccaatcatgcttattttaatttagctggg
gaagattcggcgagaacggccttagagcacgatttacaactagcggccacccattatctg
cctaccgataagggggggatcccaacaggcgaatggcgtgatgtttctgagacgtttttc
gattttcgtcgtaaaaagcgtataggctatgattttttgcaagacgatgatcaaaaagca
gttggtggttatgatcatgcgatgatcttggctccagagcttacggatggtgagcaaacg
gtcgcttcactcttttcaccagaaggtgatgttcgaatggatatcgcaacaactttgcct
gcaatgcaagtttatacagggaattatttgatttcggttccgggaaaatcacgtcattat
accccgttttcaggtgtggcctttgaaactcagtttccaccggatgccgttaaccaccct
gaatggggggagcaatacagcggtatttcacagccaaatcaaatatatcaccagaaaacg
agctatcactttattttctga

DBGET integrated database retrieval system