KEGG   Providencia stuartii: S70_03555Help
Entry
S70_03555         CDS       T02042                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psi  Providencia stuartii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(736957..737661)
Genome map
AA seq 234 aa AA seqDB search
MKHKLLLWAACIATFSASVSAATDDKVIEEKLARYSISVESIKPSPIVGLNTIDTSDGII
YVTDDGKYLLQGPIYDLSGKMPVNISNQPLMKKVEALKDEMIVFKAPKEKYVVTVFTDIT
CSYCKKFHESVGELNSKGITVRYLAYPRQGLEHESAKQMASIWCNALPQSALTKAFKGDE
VAMIDECKIDLSKHVKLGSQFKMTGTPAIVLPDGQLLSGYLSPDKLLKILEQNS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataaactactcttatgggcggcttgcattgcaacattttccgcctcagtgtct
gcggcaacagatgataaagtgattgaagagaagcttgccagatatagtatctctgtagaa
tcaatcaaaccatcgcctattgtagggcttaatactattgatacttcagatggtattatt
tatgtaactgatgatgggaaatatttattacaaggccctatttatgatttaagcggcaaa
atgccagtcaacatttctaatcaaccactcatgaaaaaggttgaagcgctaaaagatgaa
atgatcgtctttaaagcgccgaaagagaagtatgtggttacagtatttaccgatattacc
tgtagctactgcaaaaaattccatgaatcggttggtgaattaaatagcaaaggtatcaca
gtacgttacctcgcttacccacgccaaggtttggagcatgagtccgcaaaacaaatggca
tctatatggtgtaatgcgctccctcaaagtgcattaactaaagcatttaaaggtgacgaa
gttgccatgattgatgaatgtaaaattgatctcagtaaacacgttaagttaggtagccaa
tttaaaatgacaggaacgccagcgatcgtgttacctgatgggcaattattgtcgggttat
ttatcccccgataaactgttaaagatactcgaacaaaatagttaa

DBGET integrated database retrieval system