KEGG   Providencia stuartii: S70_03755Help
Entry
S70_03755         CDS       T02042                                 

Gene name
aceF
Definition
pyruvate dehydrogenase dihydrolipoyltransacetylase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psi  Providencia stuartii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S70_03755 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_03755 (aceF)
   00020 Citrate cycle (TCA cycle)
    S70_03755 (aceF)
   00620 Pyruvate metabolism
    S70_03755 (aceF)
Enzymes [BR:psi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     S70_03755 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(777809..779674)
Genome map
AA seq 621 aa AA seqDB search
MSIEIQVPDIGADEVEVTEVMVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVTTGKLIMVFESAEGAAPAASAEAPAAPAAAPTAAALKEVSVPDIGGDEVEVTEIM
VKVGDTVAEEQSLITVEGDKASMEVPAPFAGTVKEIKIATGDKVKTGSLIMVFEVAGSAP
AAEAAPASAPASAPAASAIKDVNVPDIGGDEVEVTEVMVKVGDTVSAEQSIITVEGDKAS
MEVPAPFAGTVKEIKIATGDKVKTGSLIMTFEVAGAAPAASAPTASPAPAASAPAAAQAP
APAKAADSKNEFVENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQSYVKDA
IKRAEAPAAAGGGLPGMLPWPKVDYSKFGEVEEVELGRIQKISGANLSRNWVMIPHVTLM
EEVDTTDVEDFRKQQNKEAEKKQLGVKITPLVFVMKAVARALEEMPRFNSSISEDGQRLF
MKKYVNIGIAVDTPNGLVVPVIKDVNKKGIMELSRELMEVSKKARAGKLTASDMQGGCFT
ISSLGGIGTTGFAPIVNAPEVAIMGLSRSSIKPVWNGSEFVPRLMLPMSLSFDHRVIDGA
DGARFITLVGQLMSDIRRLVM
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaaatccaagtgcctgatatcggtgctgatgaagttgaagtcaccgaagtt
atggttaaagttggtgataaagtagaagcagagcaatcgctgatcactgttgaaggcgat
aaggcatctatggaagtcccatcaccacaagcaggtgtggttaaagaaattaaaattgca
gtaggtgataaagttaccactggcaaattgatcatggtctttgaatcagcagaaggcgcg
gctccggctgcgtcagcagaagcaccagcggcaccagccgctgccccaacagcagcagct
ctgaaagaagtgtctgtccctgatattggcggcgatgaagtcgaagtgactgagatcatg
gtaaaagtaggtgatacagttgcagaagagcaatcgctgatcactgttgaaggtgacaaa
gcttccatggaagttcctgcaccctttgctggtactgtaaaagagatcaagattgcgact
ggtgataaagtgaaaacaggttcactgatcatggtctttgaagttgcaggatcagcaccg
gcagcggaagcagcacccgcatcggcacctgcgtcagcgccagcagcctcggcaattaaa
gatgttaatgtacctgacatcggtggtgatgaagttgaagtcactgaggttatggtgaaa
gttggtgatactgtttcagctgagcaatcaatcattacggttgaaggcgataaagcatca
atggaagttcctgcaccctttgccggtaccgtgaaagagatcaaaatcgccactggtgat
aaagtgaaaacaggttcactgatcatgacgtttgaagttgcaggtgcagcaccagcagca
tcggcaccaactgcgtcaccagcgccagccgcttccgctccggcagccgcacaggcgcca
gcaccagcaaaagcagctgatagcaaaaatgaatttgttgaaaacgacgcttatgtacat
gcaacgccagtcatccgccgtttagcgcgtgagtttggtgttaaccttgctaaagtaaaa
ggaacgggtcgtaaaggtcgtattctgcgcgaagacgtacaatcttacgttaaagacgcc
atcaagcgtgccgaagcaccagccgctgcgggtggtggtttaccgggcatgttgccatgg
ccaaaagtggattacagcaagttcggtgaagttgaagaagttgaactgggtcgtatccaa
aaaatctctggtgctaacctaagccgtaactgggtgatgatccctcatgttacgttgatg
gaagaagtcgacactacagatgtcgaagacttccgtaagcagcagaacaaagaagctgag
aagaaacaactcggtgttaaaatcacgccactggtgtttgtgatgaaggctgttgctcgt
gcgctagaagaaatgcctcgttttaatagctctatttctgaagatggccaacgcctattc
atgaagaaatatgtcaatatcggtatcgcggttgatacgccaaatggcctagttgttcct
gttatcaaagacgtgaacaaaaaaggcattatggaactgtctcgcgaactgatggaagtt
tctaagaaagcgcgtgcaggcaaattaacagcttctgatatgcaaggtggatgcttcact
atttctagccttggtggcatcggaacaactggttttgcaccaattgttaatgcaccagaa
gttgcaattatgggtctatctcgctcttccatcaaaccagtttggaatggtagtgagttt
gtgcctcgactgatgttgcctatgtctctttcattcgaccaccgtgtgatcgacggcgct
gatggtgctcgtttcatcaccctagtaggtcaattgatgagcgacattcgtcgactggtg
atgtaa

DBGET integrated database retrieval system