KEGG   Providencia stuartii: S70_03755Help
Entry
S70_03755         CDS       T02042                                 

Gene name
aceF
Definition
pyruvate dehydrogenase dihydrolipoyltransacetylase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psi  Providencia stuartii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:psi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:psi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:psi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:psi00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(777809..779674)
Genome map
AA seq 621 aa AA seqDB search
MSIEIQVPDIGADEVEVTEVMVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVTTGKLIMVFESAEGAAPAASAEAPAAPAAAPTAAALKEVSVPDIGGDEVEVTEIM
VKVGDTVAEEQSLITVEGDKASMEVPAPFAGTVKEIKIATGDKVKTGSLIMVFEVAGSAP
AAEAAPASAPASAPAASAIKDVNVPDIGGDEVEVTEVMVKVGDTVSAEQSIITVEGDKAS
MEVPAPFAGTVKEIKIATGDKVKTGSLIMTFEVAGAAPAASAPTASPAPAASAPAAAQAP
APAKAADSKNEFVENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQSYVKDA
IKRAEAPAAAGGGLPGMLPWPKVDYSKFGEVEEVELGRIQKISGANLSRNWVMIPHVTLM
EEVDTTDVEDFRKQQNKEAEKKQLGVKITPLVFVMKAVARALEEMPRFNSSISEDGQRLF
MKKYVNIGIAVDTPNGLVVPVIKDVNKKGIMELSRELMEVSKKARAGKLTASDMQGGCFT
ISSLGGIGTTGFAPIVNAPEVAIMGLSRSSIKPVWNGSEFVPRLMLPMSLSFDHRVIDGA
DGARFITLVGQLMSDIRRLVM
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaaatccaagtgcctgatatcggtgctgatgaagttgaagtcaccgaagtt
atggttaaagttggtgataaagtagaagcagagcaatcgctgatcactgttgaaggcgat
aaggcatctatggaagtcccatcaccacaagcaggtgtggttaaagaaattaaaattgca
gtaggtgataaagttaccactggcaaattgatcatggtctttgaatcagcagaaggcgcg
gctccggctgcgtcagcagaagcaccagcggcaccagccgctgccccaacagcagcagct
ctgaaagaagtgtctgtccctgatattggcggcgatgaagtcgaagtgactgagatcatg
gtaaaagtaggtgatacagttgcagaagagcaatcgctgatcactgttgaaggtgacaaa
gcttccatggaagttcctgcaccctttgctggtactgtaaaagagatcaagattgcgact
ggtgataaagtgaaaacaggttcactgatcatggtctttgaagttgcaggatcagcaccg
gcagcggaagcagcacccgcatcggcacctgcgtcagcgccagcagcctcggcaattaaa
gatgttaatgtacctgacatcggtggtgatgaagttgaagtcactgaggttatggtgaaa
gttggtgatactgtttcagctgagcaatcaatcattacggttgaaggcgataaagcatca
atggaagttcctgcaccctttgccggtaccgtgaaagagatcaaaatcgccactggtgat
aaagtgaaaacaggttcactgatcatgacgtttgaagttgcaggtgcagcaccagcagca
tcggcaccaactgcgtcaccagcgccagccgcttccgctccggcagccgcacaggcgcca
gcaccagcaaaagcagctgatagcaaaaatgaatttgttgaaaacgacgcttatgtacat
gcaacgccagtcatccgccgtttagcgcgtgagtttggtgttaaccttgctaaagtaaaa
ggaacgggtcgtaaaggtcgtattctgcgcgaagacgtacaatcttacgttaaagacgcc
atcaagcgtgccgaagcaccagccgctgcgggtggtggtttaccgggcatgttgccatgg
ccaaaagtggattacagcaagttcggtgaagttgaagaagttgaactgggtcgtatccaa
aaaatctctggtgctaacctaagccgtaactgggtgatgatccctcatgttacgttgatg
gaagaagtcgacactacagatgtcgaagacttccgtaagcagcagaacaaagaagctgag
aagaaacaactcggtgttaaaatcacgccactggtgtttgtgatgaaggctgttgctcgt
gcgctagaagaaatgcctcgttttaatagctctatttctgaagatggccaacgcctattc
atgaagaaatatgtcaatatcggtatcgcggttgatacgccaaatggcctagttgttcct
gttatcaaagacgtgaacaaaaaaggcattatggaactgtctcgcgaactgatggaagtt
tctaagaaagcgcgtgcaggcaaattaacagcttctgatatgcaaggtggatgcttcact
atttctagccttggtggcatcggaacaactggttttgcaccaattgttaatgcaccagaa
gttgcaattatgggtctatctcgctcttccatcaaaccagtttggaatggtagtgagttt
gtgcctcgactgatgttgcctatgtctctttcattcgaccaccgtgtgatcgacggcgct
gatggtgctcgtttcatcaccctagtaggtcaattgatgagcgacattcgtcgactggtg
atgtaa

DBGET integrated database retrieval system