KEGG   Providencia stuartii: S70_04000Help
Entry
S70_04000         CDS       T02042                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
psi  Providencia stuartii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    S70_04000
Enzymes [BR:psi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     S70_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(834365..835285)
Genome map
AA seq 306 aa AA seqDB search
MINSTLGNQVDNSLVSNAFGFLRFPLNFQPYNSDAEWVITGVPFDMATSGRAGSRHGPAA
IRQVSTNLAWESHRWPWNFKLTERLNVVDCGDVVFAFGDAQDMCDKLQAHTEKLLEAGKR
CLTFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYGNGSQYDHGTMFYHAPKEGLIDP
TRSVQIGIRTEHESDNGFTVIDAAQVNDRGVDEMIEQIKSIVGDMPVYLTFDIDCLDPAF
APGTGTPVIGGLTSDRALKLLRGLQPLNIVGMDLVEVAPAYDQSDITALAAATIALDMLY
LQASKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgattaatagcacattaggtaatcaggtcgataattcactggtttctaacgcatttggc
tttttacgtttcccattaaactttcaaccttataactcagatgctgagtgggtgataacg
ggggtgccgtttgatatggcaacttctggtcgtgcgggcagccgtcatggacctgctgct
attcgtcaggtatctaccaacttagcgtgggaaagccatcgttggccatggaattttaaa
ctaacagagcgcttaaatgttgtggattgtggcgatgtggtgtttgcttttggtgatgca
caagacatgtgcgataagctacaagcacatacagaaaaattgctggaggcgggcaagcgc
tgcttaacatttggcggtgaccattttgtgactttgcctctgttgcgcgcccatgcaaag
cattttggtaaaatggcgttagtccattttgatgcacacacagacacttatggtaatggt
agccagtatgaccatggcactatgttctaccatgcaccaaaagaagggctaattgatccg
actcgttctgtacaaattggtattcgtacagagcatgaaagtgataacgggtttacagtc
attgatgccgcacaagttaatgatcgcggtgttgatgagatgatcgaacaaattaaatct
attgtgggtgatatgcctgtttatctcactttcgatattgattgtttagatcctgctttt
gcgccgggaaccggaacacctgtcattggtggattaacctcagatcgtgcattaaaactg
ttgcgtggtttacaaccgttaaatatcgttggtatggatttagttgaagtcgcaccagct
tatgatcaatctgatatcactgcattggccgcagcaaccattgctttagatatgttgtac
ttacaagcatctaaaaaataa

DBGET integrated database retrieval system