KEGG   Providencia stuartii: S70_04370Help
Entry
S70_04370         CDS       T02042                                 

Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
psi  Providencia stuartii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:psi00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(916332..917762)
Genome map
AA seq 476 aa AA seqDB search
MPGSLFPQDFLWGGAIAANQAEGACFEGGKGLSIADVIPYGANRHPVKMGIEKRFKLRDD
EYYPSHLAIDFYHQYKRDIALMVEMGFSVFRTSIAWSRLFPRGDEVTPNPEGIAYYLDLF
NECKKYHIEPLVTLCHFDVPMHLVTEYGSWRDRKMIDFFVTYAKACFEAFDGIVKYWLTF
NEINLLLHTPFSSSGLVFEAGENSEQVKYQAAHHQLVASALATKIAHEVNAQNQVGCMLA
GGGYYPWSPKPEDVWAAMEKDRENLFFIDVQVRGYYPAYAQRVFRENKVTLLVTEEDEQI
LKNTVDFVSFSYYASRCASADMGDGTNPSINAAQSLSSPYIKQSEWGWGIDPLGLRLTAN
MLYDRYQKPLFLVENGLGAHDKLNEDGEIIDDYRIDYHRSHIQALGDAIADGIPIMGYIS
WGCIDLVSASTGEMSKRYGFVYVDKDDQGAGSLTRIRKKSFWWYKKVIASHGNDLY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccaggatctctatttcctcaagattttctgtggggtggtgcaatagcggcaaatcaa
gcggagggggcttgttttgaaggggggaaaggactcagtattgcagatgttattccttat
ggagctaacaggcatccggtaaaaatggggatcgaaaaacgttttaaattacgagatgat
gaatattacccaagccatttggcaattgatttttatcatcaatacaagcgtgatattgcg
ctaatggtagaaatgggattttcggtgtttcgcacatcgattgcatggagccgtttattt
ccgcgtggggatgaagtcactccaaacccagaaggtatcgcctattatctcgacttattt
aatgaatgcaaaaaatatcatattgaaccgctagtaaccttgtgccattttgatgttccg
atgcatttggtcactgagtatggctcatggcgtgaccggaagatgattgatttttttgtg
acctatgccaaagcctgctttgaagcatttgatgggatagtgaaatattggctgacattt
aatgaaattaatttgctattgcatacgccgttttcatcatcagggttagtctttgaagcg
ggggaaaatagcgaacaagttaaatatcaagccgctcatcatcaattagttgctagcgca
ttagcgacaaaaatagcccacgaagtcaatgctcaaaaccaagttggctgtatgcttgca
ggtggtggatattacccttggtcgcctaaaccagaagatgtatgggcggcaatggaaaaa
gatcgtgaaaacttgttttttattgatgtacaggtgcgtgggtattatcccgcctatgca
caacgtgtttttcgtgaaaacaaggtgacacttctggtcacggaagaggacgagcaaatc
cttaaaaataccgtcgattttgtttcgtttagttattatgcctctcgttgtgcctcagcg
gatatgggggatggtacaaacccgtcgattaatgctgcacaatctttaagctctccgtat
ataaaacagagtgagtgggggtggggaattgaccctctcggtttaagattaaccgcaaac
atgctctatgatcgctatcaaaaaccattatttctagtagaaaatggtttgggggcgcat
gataagttaaatgaggatggtgaaattattgatgattatcgaatcgattaccatcgttca
cacattcaagctttaggtgatgctatcgctgatggtatccccattatgggatatatttca
tggggatgtattgatttagtctctgcttcaacaggcgaaatgagtaaacgatatggtttt
gtgtatgttgataaggatgatcagggagctggctcactaacaaggatacgtaaaaaatct
ttttggtggtataaaaaagtgatagcaagccatggtaatgatttgtattaa

DBGET integrated database retrieval system