KEGG   Providencia stuartii MRSN 2154: S70_04370Help
Entry
S70_04370         CDS       T02042                                 

Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_04370
Enzymes [BR:psi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     S70_04370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(916332..917762)
Genome map
AA seq 476 aa AA seqDB search
MPGSLFPQDFLWGGAIAANQAEGACFEGGKGLSIADVIPYGANRHPVKMGIEKRFKLRDD
EYYPSHLAIDFYHQYKRDIALMVEMGFSVFRTSIAWSRLFPRGDEVTPNPEGIAYYLDLF
NECKKYHIEPLVTLCHFDVPMHLVTEYGSWRDRKMIDFFVTYAKACFEAFDGIVKYWLTF
NEINLLLHTPFSSSGLVFEAGENSEQVKYQAAHHQLVASALATKIAHEVNAQNQVGCMLA
GGGYYPWSPKPEDVWAAMEKDRENLFFIDVQVRGYYPAYAQRVFRENKVTLLVTEEDEQI
LKNTVDFVSFSYYASRCASADMGDGTNPSINAAQSLSSPYIKQSEWGWGIDPLGLRLTAN
MLYDRYQKPLFLVENGLGAHDKLNEDGEIIDDYRIDYHRSHIQALGDAIADGIPIMGYIS
WGCIDLVSASTGEMSKRYGFVYVDKDDQGAGSLTRIRKKSFWWYKKVIASHGNDLY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccaggatctctatttcctcaagattttctgtggggtggtgcaatagcggcaaatcaa
gcggagggggcttgttttgaaggggggaaaggactcagtattgcagatgttattccttat
ggagctaacaggcatccggtaaaaatggggatcgaaaaacgttttaaattacgagatgat
gaatattacccaagccatttggcaattgatttttatcatcaatacaagcgtgatattgcg
ctaatggtagaaatgggattttcggtgtttcgcacatcgattgcatggagccgtttattt
ccgcgtggggatgaagtcactccaaacccagaaggtatcgcctattatctcgacttattt
aatgaatgcaaaaaatatcatattgaaccgctagtaaccttgtgccattttgatgttccg
atgcatttggtcactgagtatggctcatggcgtgaccggaagatgattgatttttttgtg
acctatgccaaagcctgctttgaagcatttgatgggatagtgaaatattggctgacattt
aatgaaattaatttgctattgcatacgccgttttcatcatcagggttagtctttgaagcg
ggggaaaatagcgaacaagttaaatatcaagccgctcatcatcaattagttgctagcgca
ttagcgacaaaaatagcccacgaagtcaatgctcaaaaccaagttggctgtatgcttgca
ggtggtggatattacccttggtcgcctaaaccagaagatgtatgggcggcaatggaaaaa
gatcgtgaaaacttgttttttattgatgtacaggtgcgtgggtattatcccgcctatgca
caacgtgtttttcgtgaaaacaaggtgacacttctggtcacggaagaggacgagcaaatc
cttaaaaataccgtcgattttgtttcgtttagttattatgcctctcgttgtgcctcagcg
gatatgggggatggtacaaacccgtcgattaatgctgcacaatctttaagctctccgtat
ataaaacagagtgagtgggggtggggaattgaccctctcggtttaagattaaccgcaaac
atgctctatgatcgctatcaaaaaccattatttctagtagaaaatggtttgggggcgcat
gataagttaaatgaggatggtgaaattattgatgattatcgaatcgattaccatcgttca
cacattcaagctttaggtgatgctatcgctgatggtatccccattatgggatatatttca
tggggatgtattgatttagtctctgcttcaacaggcgaaatgagtaaacgatatggtttt
gtgtatgttgataaggatgatcagggagctggctcactaacaaggatacgtaaaaaatct
ttttggtggtataaaaaagtgatagcaagccatggtaatgatttgtattaa

DBGET integrated database retrieval system