KEGG   Providencia stuartii MRSN 2154: S70_04830Help
Entry
S70_04830         CDS       T02042                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    S70_04830
Enzymes [BR:psi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     S70_04830
   3.1.2  Thioester hydrolases
    3.1.2.-  
     S70_04830
Lipid biosynthesis proteins [BR:psi01004]
 Fatty acid synthase
  Component type
   S70_04830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
994547..995185
Genome map
AA seq 212 aa AA seqDB search
MNFKNIFRRHLLVFLLLFVASGQALAATKLLILGDSLSAGYRLPAEQAWASLLAERWQKS
SPPVIVINGSISGNTSAQGLERLPALLEQHKPDWVLIELGANDGLQGLSVKQMENTLQQI
IEQITQSGAKPLLMQIRIPPNYGKRYTSSFENVYPALAQQNAVPLLPFYMETIITKPEWI
QQDGIHPTVEAQPSIADFMEKQLLPYLTSSAN
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaatattttccgccgacatttactggtatttctcctattatttgtcgca
agtgggcaagcactcgcagccacaaaactgttaatccttggtgacagcctcagtgcaggc
tatcgcttaccggcagagcaagcatgggcttcactccttgccgaacgttggcagaaatcg
tcgccacccgttattgtcattaacggtagcattagtggaaacacctcagcccaagggcta
gagcgccttcctgccttacttgaacaacacaaacccgattgggtattgatcgagttaggt
gcaaacgatggtttgcaagggctatctgttaaacagatggagaacacactacaacaaatt
attgaacaaataacgcagtccggtgcgaaaccgcttttaatgcaaattcgtataccgccg
aactacggtaagcgttatacttctagtttcgaaaatgtttatcctgcacttgcacaacaa
aacgcggttccactactgcctttttatatggaaaccatcattactaaacctgagtggatc
caacaagatggtattcacccaactgtagaagctcaaccttctatcgctgattttatggaa
aaacaattactcccttatttaacttcttcagcaaattaa

DBGET integrated database retrieval system