KEGG   Providencia stuartii MRSN 2154: S70_05380Help
Entry
S70_05380         CDS       T02042                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    S70_05380
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    S70_05380
Enzymes [BR:psi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     S70_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1119870..1122269
Genome map
AA seq 799 aa AA seqDB search
MINKLTSAIVISSLIYSLPSGAQSLSELPLMPWPQQVEVKNADGKWVLNNTLDIYVEGDD
LGDATRRWRERIETQTGWQLTPHQANNTQAPIKIFIEKKVPELPSLQMDESYQITTDNHG
ATIKAATRFGAMRAMETLLQLIQTDGENTFIPLLTIKDSPRFAWRGVMLDSSRHFLPIND
ILRQIDGMAAAKLNVFHWHLTDDQGWRFESLSYPKLQQLASDGQYYTQDQMRQVVAYAKE
RGIRVVPEIDFPGHASAIAVAYPELMSAAGPYQMERHWGVHQPLLNPTQENVYQFTDSLI
NELTTIFPDEYIHIGGDEVDPTQWKNNPSIQEFMQKNNLKDTHALQAYFNQRLEQILTKH
NRKMVGWDEIQHPSLSKNIVIQSWQGQDSLGDSAQEGFKGLLSTGFYLDQSQSAAYHYRN
EILPQPLTVETNVKQGEQSQSWQFEIERLKGSPVKGSFTLIKGSNGWRGFIDFAGKSRRE
INKIEWFSPKQVSFSVDTWMGETRPVVTLTDDKLSGYTIIGNARYPTTGTHLTAIPEGIA
PTTPDNNKMTNILGGEIALWAENIRAPIIDTKLWPRAFAVSERLWSAKDVNNENDMYRRL
NATDAWSTISVGLQQHAQTAREFTRLANGVEIEPLMILSESVEPAHYYTRHHLKWRENQY
HQYEPLNRFVDALPAESMQARAFRQHIDALIAKPNDTAAAQWLEQRLKRWQDNIPQVQRL
IKQNANLVRLTPVTENVEQLTVIGLELIKHYTTGEPLAESRKAAILQQLEKSSGLQDEVV
IAIVEPLEKLLRHIPTTGQ
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaaacttacgtctgctatcgtcatatcctcacttatttactcattaccaagc
ggagcacaatcattatctgaattaccgctcatgccttggccacagcaagttgaagtaaaa
aatgccgatggaaaatgggtattaaataatacgctagatatttatgtagaaggcgatgat
ttaggtgatgcaacccgtcgttggcgtgaaagaatagagacccaaacaggctggcaatta
acaccacaccaagcaaacaacactcaagccccgataaaaatttttatcgagaaaaaagta
cctgaattgccatctctacaaatggacgaaagttatcaaatcacaacagataaccatggc
gccacgatcaaagcggcaacccgatttggtgcaatgcgagcgatggaaacattattacaa
ttgatacaaacagatggggaaaatacgtttatcccactgcttacaattaaagacagtccg
cgttttgcttggcgcggtgtgatgcttgattcttcacgacattttttaccaatcaatgat
atcttgcgccaaattgatggtatggcagccgctaagttaaacgtttttcattggcaccta
accgatgaccaaggttggcgttttgagtcacttagctaccctaaattacaacagctagcc
agtgatggccaatactatactcaagatcaaatgcgccaagttgtcgcctatgccaaagaa
agaggaattcgggtggtgcctgaaattgatttccctggtcatgcctcagctattgctgtt
gcctaccctgagcttatgagcgcagctggcccttaccaaatggaacgtcactggggagtg
catcagcctctacttaatccaacccaagaaaatgtgtaccaatttacagatagcttaatt
aacgagttgaccactatcttcccagatgaatatatccatattggcggagatgaggttgac
ccaacccaatggaaaaacaatccatctattcaggagtttatgcaaaaaaacaacctgaaa
gatacccatgcactacaggcttatttcaatcaacggcttgaacaaatcctcacaaaacat
aaccgtaaaatggtcggctgggatgaaattcaacacccttcactatcaaaaaatattgtt
attcagtcgtggcaaggacaagattctttaggcgatagcgctcaagaaggatttaaaggt
ttactttcaaccggtttctatctcgatcaatctcaaagtgcggcataccattatcgaaat
gagatactacctcagccacttactgtagagacaaatgttaaacagggtgaacaatcgcaa
agttggcaatttgaaatcgaaaggttaaaaggtagccccgtcaaaggtagttttacatta
ataaaggggtcaaatggatggcgtggatttattgattttgcaggtaaatcacgtcgagaa
attaataagattgagtggttttcgcctaaacaagtcagtttttcagtggacacttggatg
ggagaaactcgtcctgttgttactttaacggatgataaattaagcggttataccataata
ggtaatgctcgctatccaacgacaggaacccacttaacagccattcccgaaggaattgcg
ccaaccacgcccgacaataataaaatgaccaatattctcggcggggaaattgcgttatgg
gctgaaaatattcgcgctcccatcattgatactaagctatggccacgtgcttttgccgta
tccgagcgcctatggtctgcaaaagatgtcaataatgagaatgacatgtatcgtcgccta
aacgcaacagatgcttggtcaaccatttcggtgggtttacagcagcatgcacaaacggcc
cgtgaatttacacgtttagcaaatggcgttgaaattgagcctttgatgatcctctctgaa
tctgtagagcctgcacattactatactcgccatcatcttaagtggagagaaaaccaatat
catcaatatgaacctcttaaccgatttgtcgatgctttaccggccgaaagtatgcaagca
agagccttccgccagcatattgacgcattaatcgctaaaccgaatgatacagcggcagca
caatggttagagcagagattaaaacgttggcaagataatattccacaagtccagcgtctt
attaaacagaatgctaacttagttaggttaacgcctgttaccgagaatgtggaacaattg
acggtgattggtttagaactgattaagcattatacgacaggtgagccgttagccgagagc
cgtaaagcagctattttgcagcagttagaaaaaagctcaggtttgcaagatgaagttgtc
attgcaattgtcgaaccactagaaaaactactccgccacatcccgacaacaggtcaatag

DBGET integrated database retrieval system