KEGG   Providencia stuartii MRSN 2154: S70_05890Help
Entry
S70_05890         CDS       T02042                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00330  Arginine and proline metabolism
psi00332  Carbapenem biosynthesis
psi01100  Metabolic pathways
psi01130  Biosynthesis of antibiotics
psi01230  Biosynthesis of amino acids
Module
psi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    S70_05890
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    S70_05890
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     S70_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA PrpR_N
Motif
Other DBs
NCBI-ProteinID: AFH93051
UniProt: A0A140NJH0
Position
complement(1230478..1231581)
Genome map
AA seq 367 aa AA seqDB search
MKNSQTLVVKLGTSVLTGGSRQLNQAHIVELVRQCAQQYQKGHRIIIVTSGAIAAGREHL
NYPELPATIASKQLLAAVGQSRLIQLWERLFSIYGIHIGQMLLTRADLEDRERFLNARDT
LQALLDNGIVPVINENDAVATAEIKVGDNDNLSALAAILGDADKLLLLTDIEGLFDSDPR
SNPNAKLIPEVYGINDELREMAGGSVTGLGTGGMATKLQAADVAGRAGIDVIIAAGNKPD
VINAVIEDIPVGTRFYGQKNPMENRKRWIFGAPAAGDIYIDDGAQLAIMEKGSSLLPKGI
KKIEGDFSRGAVVRIRNMAGKDLAHGVTHYNSDALRMIAGHHSQEIGRILGYEHGSVAVH
RDDMIVG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagccagacacttgttgttaaattaggcactagtgtattgaccggaggctca
cggcaattgaaccaagctcatattgttgagttagtcaggcagtgtgcgcaacaatatcaa
aaagggcatcgtattattattgtcacgtctggcgctatcgctgctggtcgtgaacacctt
aattaccccgagcttccagcgacaatcgcgtcgaagcagcttcttgcagcggtagggcaa
agccgccttattcagttatgggaacgtctattctctatttatggtattcatattgggcag
atgctgttgacacgggctgatctggaagacagagagcgctttttgaatgcacgagataca
ttgcaggctctgcttgataatggcattgtgcctgtgattaatgagaatgatgctgtcgca
accgctgaaattaaagtgggggataatgataatttatcagcccttgccgctatccttggt
gatgctgacaaattgctattattgacagatattgaagggttatttgattctgaccctcgt
agtaacccgaatgcaaaactgatcccagaagtgtatggcatcaatgatgaattgcgtgaa
atggcggggggaagtgttactggtctggggacgggggggatggcaactaagttgcaagcc
gccgatgttgcaggaagagcaggaatagatgtcattattgcggcaggtaataagccagat
gtgatcaacgcggtgattgaagatattccagtaggcacgcggttttatgggcagaaaaac
ccaatggaaaaccgcaagcgttggatctttggtgctccagcggctggcgatatatatatc
gatgatggcgctcaacttgctattatggaaaaaggaagctccttactgccgaaaggcatc
aaaaaaattgaaggtgatttttcccgtggtgccgttgtacggatacggaatatggcaggt
aaagatcttgctcacggggtcactcattataatagtgacgctttaagaatgattgcgggc
catcattcacaggaaataggccgcatactgggctatgaacatggctctgtagctgtccac
cgcgacgatatgatagtgggttaa

DBGET integrated database retrieval system