KEGG   Providencia stuartii: S70_05890Help
Entry
S70_05890         CDS       T02042                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
psi  Providencia stuartii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S70_05890
  Amino acid metabolism
   00330 Arginine and proline metabolism
    S70_05890
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     S70_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1230478..1231581)
Genome map
AA seq 367 aa AA seqDB search
MKNSQTLVVKLGTSVLTGGSRQLNQAHIVELVRQCAQQYQKGHRIIIVTSGAIAAGREHL
NYPELPATIASKQLLAAVGQSRLIQLWERLFSIYGIHIGQMLLTRADLEDRERFLNARDT
LQALLDNGIVPVINENDAVATAEIKVGDNDNLSALAAILGDADKLLLLTDIEGLFDSDPR
SNPNAKLIPEVYGINDELREMAGGSVTGLGTGGMATKLQAADVAGRAGIDVIIAAGNKPD
VINAVIEDIPVGTRFYGQKNPMENRKRWIFGAPAAGDIYIDDGAQLAIMEKGSSLLPKGI
KKIEGDFSRGAVVRIRNMAGKDLAHGVTHYNSDALRMIAGHHSQEIGRILGYEHGSVAVH
RDDMIVG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagccagacacttgttgttaaattaggcactagtgtattgaccggaggctca
cggcaattgaaccaagctcatattgttgagttagtcaggcagtgtgcgcaacaatatcaa
aaagggcatcgtattattattgtcacgtctggcgctatcgctgctggtcgtgaacacctt
aattaccccgagcttccagcgacaatcgcgtcgaagcagcttcttgcagcggtagggcaa
agccgccttattcagttatgggaacgtctattctctatttatggtattcatattgggcag
atgctgttgacacgggctgatctggaagacagagagcgctttttgaatgcacgagataca
ttgcaggctctgcttgataatggcattgtgcctgtgattaatgagaatgatgctgtcgca
accgctgaaattaaagtgggggataatgataatttatcagcccttgccgctatccttggt
gatgctgacaaattgctattattgacagatattgaagggttatttgattctgaccctcgt
agtaacccgaatgcaaaactgatcccagaagtgtatggcatcaatgatgaattgcgtgaa
atggcggggggaagtgttactggtctggggacgggggggatggcaactaagttgcaagcc
gccgatgttgcaggaagagcaggaatagatgtcattattgcggcaggtaataagccagat
gtgatcaacgcggtgattgaagatattccagtaggcacgcggttttatgggcagaaaaac
ccaatggaaaaccgcaagcgttggatctttggtgctccagcggctggcgatatatatatc
gatgatggcgctcaacttgctattatggaaaaaggaagctccttactgccgaaaggcatc
aaaaaaattgaaggtgatttttcccgtggtgccgttgtacggatacggaatatggcaggt
aaagatcttgctcacggggtcactcattataatagtgacgctttaagaatgattgcgggc
catcattcacaggaaataggccgcatactgggctatgaacatggctctgtagctgtccac
cgcgacgatatgatagtgggttaa

DBGET integrated database retrieval system