KEGG   Providencia stuartii MRSN 2154: S70_07285Help
Entry
S70_07285         CDS       T02042                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00260  Glycine, serine and threonine metabolism
psi00750  Vitamin B6 metabolism
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01230  Biosynthesis of amino acids
Module
psi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S70_07285
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    S70_07285
Enzymes [BR:psi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     S70_07285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFH93326
UniProt: A0A140NMF1
Position
complement(1523782..1525074)
Genome map
AA seq 430 aa AA seqDB search
MKLYNLKDNSEQVSFAQAVKQGLGKQQGLFFPQDLPEFSAAEIDELLKLDFVTRSSRILT
AFIGDEIPEAELAARVKEAFAFPAPVTQVEQDVATLELYHGPTLAFKDFGGRFMAQALAQ
VAGDQPVTILTATSGDTGAAVAHAFYRLNNVQVVILYPEGKISPLQEKLFCTLGENIHTV
AIKDDFDACQALVKQSFDDEALKKALHLNSANSINISRLLAQICYYFEAVAQIPAEKREQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNVNDTVPRYLEGGEWKPHQTVATLSNA
MDVSQPNNWPRIEELFRRKGWSLKELGYGAVTDEVTKETVRELDKKGYVSEPHAAVAYRV
LRDQLQDGEYGLFLGTAHPAKFKESVEAILNKQLPLPEALAERAELPLLSHFLPSDFAKL
RAFLMERAPK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttgaaagataatagcgagcaagtgagcttcgcacaggcagtaaaa
cagggattgggcaaacaacaaggtctattcttcccacaagatttgccagagtttagcgct
gctgaaattgatgagctactaaaactggattttgtcactcgtagcagccgtattttaacg
gcatttattggtgatgagatccctgaagctgagctggcggctcgcgtcaaagaagctttt
gcattccctgctcctgttactcaagttgagcaagatgtagcgacactagagctataccat
ggtccaacactcgcctttaaagactttggtggccgttttatggctcaagcacttgcccaa
gttgctggtgaccagcctgtgactattttaactgcaacctctggggatacaggggcggcg
gttgcacacgcattttaccgtttaaataatgtgcaagtggttattctctatccagaaggt
aagatcagcccactacaagaaaagctcttttgtaccctaggtgaaaacattcacacggtt
gcaatcaaagatgactttgatgcctgccaagccttggtcaaacaatcttttgatgatgag
gcgctgaaaaaagcattgcatttaaactcagcgaactcaatcaacattagccgtttgtta
gcacaaatttgttactactttgaagcggttgctcaaatccctgctgagaagcgtgagcaa
ctcgttatttctgttccaagtggtaattttggtgatttaactgcgggcttacttgctaaa
tcgctgggcttaccgattaaacgctttattgctgcaactaacgtcaatgatacggttcct
cgttaccttgaaggtggggagtggaaaccacatcaaaccgttgcgactttatcgaatgcg
atggatgtgagccaacctaataactggccgcgtattgaggagctattccgtcgtaaaggg
tggtctctgaaagagcttggttatggagcggtgaccgatgaggtgactaaagaaacggtg
cgtgagttagataaaaaagggtatgtatctgagccgcacgcagctgtcgcttaccgtgtt
ttacgcgatcaattacaagatggtgagtatggtttgttcttaggaacggcgcatcccgct
aagtttaaagagagtgtagaggcgattttgaataaacaacttcctctaccagaagcttta
gctgagcgtgctgagctacctctgctatcacactttttgccgtcggattttgcgaagcta
agggctttcttaatggaacgtgcacctaaatag

DBGET integrated database retrieval system