KEGG   Providencia stuartii MRSN 2154: S70_07420Help
Entry
S70_07420         CDS       T02042                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    S70_07420
Enzymes [BR:psi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     S70_07420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1557162..1558484)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGKPLSEEEIRFFINGVRDNSVSEGQIAALAMTIYFNDMTMAERVALT
LAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPNFDIFPNDERFRDIIRDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILGKKLAEGLDALVMDVKVGSGAFMPTYEKSEQLAESIVKVANGAGCKTTALLT
DMNEVLASSAGNAVEVREAVQFLTGEYRNPRLYEVTMALCVEMLVSGSLAANREEARQKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYNKYLPTAVLSKAVYAEKAGIITAMDTRALG
MSVVTLGGGRRKATDPIDYSVGLSDIAALGTSVDNQTPLAIIHANSEKSWEEAAKEVRAA
MVIGDQKPETTPMVYRQISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctggcacaagaaattatccgtaaaaaacgtgatggcaaaccactgagcgaagaa
gaaattcgtttcttcattaatggtgtacgcgataattcagtttctgaaggtcaaatagcc
gctttggcaatgaccatctattttaatgatatgaccatggctgagcgtgttgccctgacg
ttagcaatgcgtgattcaggcaccgttttaaattggaaatcattaaacttaaatggccca
ctcgtcgataaacactctacgggtggcgttggtgatgtcacctcattgatgttaggtcca
atggtagcggcatgtggcggctatgttccgatgatttcggggcgtggtttaggccatacc
ggtggcacactggataagcttgaagcgatccctaatttcgatattttccctaatgatgag
cgttttcgtgacattattcgtgacgttggtgttgcaattattgggcagacgagttcactc
gcacctgcggataaacgcttttacgcaacacgtgatatcactgcaacggttgactctatt
ccactgattactgcctctattttaggtaaaaaattggcagagggccttgatgctctagtc
atggatgttaaggtgggttcaggtgcatttatgccaacctacgaaaaatcagagcaactg
gctgagtccattgttaaagtcgctaatggtgcggggtgtaaaacaaccgcactgttaacc
gacatgaatgaagtactcgcttctagtgccggtaatgcggttgaagtacgcgaagccgtt
cagttcttaacgggcgaataccgtaaccctcgtttgtatgaagtgacgatggcgctgtgt
gttgaaatgctggtgtctggttcattggcggcaaatagagaagaagctcgccaaaaatta
caagcagtcttagataacggtaaggcagcggaagtctttggtcgtatggttgcggctcaa
aaaggcccaagtgactttgttgaaaactacaacaaatatttgcctactgctgtactgagc
aaagcggtgtatgcagagaaagcgggtataattaccgcgatggatacacgtgcgctcggc
atgtctgttgtgacattaggtggtggtcgtcgtaaggcaacggatccgattgattatagt
gttggtttgagcgatatcgccgcgttaggtacttcggttgataatcaaactccactagca
attattcatgctaatagcgagaaatcgtgggaagaagcggcaaaagaggtgcgtgcagcc
atggttattggtgatcaaaaaccagaaacaacgccaatggtttatcgccaaattagtgaa
taa

DBGET integrated database retrieval system