KEGG   Providencia stuartii MRSN 2154: S70_07495Help
Entry
S70_07495         CDS       T02042                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    S70_07495
   00240 Pyrimidine metabolism
    S70_07495
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    S70_07495
   03430 Mismatch repair
    S70_07495
   03440 Homologous recombination
    S70_07495
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     S70_07495
DNA replication proteins [BR:psi03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     S70_07495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1576304..1576714)
Genome map
AA seq 136 aa AA seqDB search
MARRDRLLNQMGITQWVVRNPAVLRGERGVRIPDSTKLIIITDENLDLNNRLLKDIFLAM
KIYPTDVVCINSEQLAMLPTPITINCWVLGGQSHPEGLNTTFISPVLDELAASNSAKRAL
WEQIYQYDENFSTKAV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacgtgacagacttttaaatcaaatgggtatcactcaatgggtagtgagaaac
cctgctgtattacgtggtgaacgtggtgtaagaattccagattcgactaagcttattatt
attactgatgagaaccttgatttaaacaaccgtctgttaaaagatatttttctggcgatg
aaaatttatccaacggatgtggtttgtattaattcagagcaattggcaatgcttccaaca
ccaataacaataaattgttgggtcttaggcggccaatctcatccagaagggttaaataca
acctttatttctcctgtattagatgagctggcagccagcaatagcgctaaacgggcactt
tgggagcagatttatcaatatgacgaaaatttcagcactaaagcagtctga

DBGET integrated database retrieval system