KEGG   Providencia stuartii MRSN 2154: S70_07695Help
Entry
S70_07695         CDS       T02042                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00071  Fatty acid degradation
psi00280  Valine, leucine and isoleucine degradation
psi00281  Geraniol degradation
psi00310  Lysine degradation
psi00362  Benzoate degradation
psi00380  Tryptophan metabolism
psi00410  beta-Alanine metabolism
psi00640  Propanoate metabolism
psi00650  Butanoate metabolism
psi00903  Limonene and pinene degradation
psi00930  Caprolactam degradation
psi01040  Biosynthesis of unsaturated fatty acids
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
psi01200  Carbon metabolism
psi01212  Fatty acid metabolism
Module
psi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    S70_07695 (fadB)
   00650 Butanoate metabolism
    S70_07695 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    S70_07695 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    S70_07695 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S70_07695 (fadB)
   00310 Lysine degradation
    S70_07695 (fadB)
   00380 Tryptophan metabolism
    S70_07695 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S70_07695 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    S70_07695 (fadB)
   00281 Geraniol degradation
    S70_07695 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S70_07695 (fadB)
   00930 Caprolactam degradation
    S70_07695 (fadB)
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     S70_07695 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     S70_07695 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     S70_07695 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     S70_07695 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFH93408
UniProt: A0A140NL84
Position
1631224..1633416
Genome map
AA seq 730 aa AA seqDB search
MLYQSETIYVQWLKTGIAELVFNSPGPINKLDTHTVASLDEAVAVLEQQSGLLGVILRSD
KPAFIVGADIKEFLSLFEAPAETLSEWLGYANGIFNRIEDLPVPTLSAINGYALGGGCEC
ILSTDLRIATPDARIGLPETKLGIMPGFGGSVRLPRLIGLDSALEIITAGKDISAAESLK
FGLVDAVVETDKLVESALALIESAIAGAINWQQRRQPKLQPLQLSPIEQSMSFNVAKGMV
YKVAGKHYPAPMTAVNTIEKAANCARTEALKHETAAFVPLAHSDVARSLVSIFLNDQQVK
STSKQLSRHVEAPQHAAVLGAGIMGGGIAYQSASKGVPVLMKDINEKSLDLGIEEAHKLL
NGQFERGKINASKMAKTLASIHPSLSYAGIENSQVIVEAVVENPKIKAAVLTEVEALVSP
ETILASNTSTIPITELAKSLKRPENFCGMHFFNPVHRMPLVEVIRGQKTSEDTIAKVVAY
ANKMGKTPIVVNDCPGFFVNRVLFPYFAGFNLLLQDGADFREIDKVMEKEFGWPMGPAYL
LDVVGIDTASHAEHVMALGFPERMSKTGKNAIDVMFEEKRFGQKNGKGFYQYEKDKKGKP
KKVDDPATDALLASISQGKRSFTKEEIIARMMIPMINEVVRCLEEGIIQSPADADIALVY
GLGFPPFRGGVFRYLDTVGTQSYAKTAEAYAQLSPLYQIPAGLKEKSQANSSYYAKPPVV
AIDIKKVARG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcaaagtgaaacaatctatgttcaatggttgaaaacaggtattgcagaactc
gtttttaactcgcctgggccaataaataaattggatactcataccgttgcttcacttgat
gaagcagttgctgtacttgaacagcaatcaggcctattaggcgttattctaagatctgac
aagcctgcatttattgttggggcagatatcaaagagtttctttcactttttgaagcacca
gcagagaccctaagcgagtggttaggctacgcaaatggtatttttaatcgtatcgaagac
ttacctgttcctactcttagcgccattaatgggtatgcgctaggtggaggctgtgaatgt
attctttctactgacttacgtattgctactccagatgcgcgtattgggttacctgaaacg
aaactcggtattatgccgggctttggcggctctgttcgtttacctcgattaatcggttta
gatagcgccctagaaattattaccgcaggcaaagacattagtgccgcagaatcactcaaa
ttcggcttggttgatgccgttgttgagacggacaaacttgtagaatcagcccttgccctc
attgaatcagcaatcgcaggagcgattaattggcagcaaagacgtcaacctaagttacaa
ccattacaacttagccctattgaacagagcatgagctttaatgttgcaaaaggtatggtg
tataaggttgcaggaaaacactatcccgcccctatgacggcagtcaataccattgaaaaa
gcagccaactgtgctcgtactgaagccctaaaacatgaaacagcagcttttgttccactt
gctcatagcgatgttgctcgctcattagttagtattttcttaaatgatcagcaagttaaa
tcaacaagcaaacagctttctcgtcacgttgaagcccctcaacatgccgcagtactagga
gcaggaattatgggaggtggaatagcctaccagtccgcaagtaaaggcgttcctgtgctc
atgaaggatattaatgaaaaatctttagatttaggcatcgaagaggctcataaactatta
aatggtcaatttgagcgcgggaaaatcaatgcctcaaaaatggcgaaaacactcgcatcg
attcatccttcgctttcttacgcgggtatcgaaaattcacaagtgatcgtggaagcggtc
gttgaaaaccccaaaattaaagccgctgtgctgacggaagttgaagcattagttagccca
gaaacaattttagcgtctaatacgtcgaccataccgattactgagctagcgaagtcgtta
aaacgtcccgaaaatttttgtggtatgcacttcttcaaccctgtgcatcgcatgccgctt
gttgaggttattcgtggtcaaaaaacctcagaggataccatcgccaaagtcgtcgcttac
gccaacaaaatgggtaaaacccccattgtcgttaatgactgccctggtttcttcgtcaat
agggttcttttcccttactttgcaggttttaacttactgctacaagatggtgcagatttc
agagaaatcgataaagtcatggaaaaagaatttggctggccgatgggacctgcatatctt
cttgatgtagttggtattgataccgcatcccatgcagagcatgtaatggcactagggttc
cctgagcgcatgagtaaaacaggcaaaaatgctattgatgttatgtttgaagaaaaacgg
tttgggcaaaaaaatggcaaaggcttttatcaatatgaaaaagataaaaaaggaaagcca
aagaaagttgatgaccccgccacagatgcattactcgcctcaatcagtcaaggcaagcgc
tcatttacaaaagaagagatcattgcacgtatgatgatcccgatgatcaatgaggtcgtt
cgttgcttagaagagggcatcattcaaagccctgccgatgcagacatcgctttagtttac
ggccttgggttccctcctttccgaggaggcgtcttccgctacttagataccgttggcaca
caatcttatgctaagacagcggaggcctatgctcagttaagccctctgtatcaaattcct
gcgggtctcaaagaaaaatctcaggccaattccagttattatgcgaagccacctgtagtg
gcaattgatattaaaaaagttgcgagaggctaa

DBGET integrated database retrieval system