KEGG   Providencia stuartii MRSN 2154: S70_08470Help
Entry
S70_08470         CDS       T02042                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S70_08470
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    S70_08470
Enzymes [BR:psi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     S70_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1804810..1806117)
Genome map
AA seq 435 aa AA seqDB search
MTISRAEQIAQLENEWKKARWEGITRPYSAEEVVKLRGSVNPEHTLATRGAQRLWDQLHG
HSKKGYVNALGALTGGQALQQAKAGIEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPS
VVKKINNTFRRADQIQWANGIGPENKEYIDFFLPIVADAEAGFGGVLNAFELMKGMIEAG
AAAVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVSGVPTILIARTDADAAD
LLTSDCDPYDAEFITGERTNEGFFRTKAGIEQAISRGLAYAPYADLVWCETSKPDLEAAR
QFAEAIHAKYPGKLLAYNCSPSFNWKRNLDDATIARFQDELSAMGYRFQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQEREFAAIDKGYTFSSHQQEVGTGYFDKVTTVIQGGT
SSVTALTGSTEEEQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgatatcacgcgcagagcagattgcccaattagagaatgagtggaaaaaagcacgt
tgggaagggatcactcgcccttatagtgctgaagaagtggtgaagctgcgtggttcagtt
aacccagaacatactctagcgaccagaggggcacaaaggttatgggatcaactccatggc
cattctaaaaaaggttatgtgaatgccttaggtgccttaacggggggacaagcattacag
caagccaaagcgggaattgaagctatttatctttctggctggcaagtggcagcggatgcg
aacacggcatcaagtatgtaccctgaccaatcgttatacccggtcgattcggttccttcg
gtcgtgaaaaagataaacaacacgttccgtcgggcggatcaaattcaatgggctaatggg
attgggccagaaaataaggaatacattgatttcttcctccctatcgttgctgatgctgaa
gcgggatttggtggggtgctaaatgcctttgaactaatgaaaggtatgattgaagcggga
gctgctgcggtacattttgaagatcagctcgcggcggttaaaaaatgtggtcatatgggt
ggaaaggtactagtaccaacccaagaggcgatacaaaagttagttgcggctcgtttagca
gcagatgtgtcgggagtaccaacgattttaatcgcgagaacggatgcagacgccgccgat
cttttaacgtcggattgcgacccgtatgatgccgaatttattacaggggaaagaaccaac
gaaggctttttccgtactaaagcgggcattgagcaagccattagccgtgggctcgcttac
gcgccatatgctgatttggtctggtgtgaaacatcaaaacctgatttagaggcggctcgc
caatttgccgaggcgatccacgcgaaatacccgggtaaattactggcttataattgctca
ccttcctttaactggaagagaaatttggacgatgcgacgattgctcgcttccaagatgag
ctttcagcgatgggttaccgcttccagtttatcacattggcgggtattcatagcatgtgg
tttaacatgtttgatttagctcatgcgtatgcacaaggtgaaggtatgaagcactacgta
gagaaagttcaggagcgtgagtttgctgcgattgataagggttataccttctcttcgcat
cagcaggaggtgggaacgggttattttgataaggtaacgactgtgatccaaggtggaaca
tcgtcagtcactgcgctgacaggttcgacggaagaagagcagttttaa

DBGET integrated database retrieval system