KEGG   Providencia stuartii MRSN 2154: S70_08470Help
Entry
S70_08470         CDS       T02042                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S70_08470
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    S70_08470
Enzymes [BR:psi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     S70_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1804810..1806117)
Genome map
AA seq 435 aa AA seqDB search
MTISRAEQIAQLENEWKKARWEGITRPYSAEEVVKLRGSVNPEHTLATRGAQRLWDQLHG
HSKKGYVNALGALTGGQALQQAKAGIEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPS
VVKKINNTFRRADQIQWANGIGPENKEYIDFFLPIVADAEAGFGGVLNAFELMKGMIEAG
AAAVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVSGVPTILIARTDADAAD
LLTSDCDPYDAEFITGERTNEGFFRTKAGIEQAISRGLAYAPYADLVWCETSKPDLEAAR
QFAEAIHAKYPGKLLAYNCSPSFNWKRNLDDATIARFQDELSAMGYRFQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQEREFAAIDKGYTFSSHQQEVGTGYFDKVTTVIQGGT
SSVTALTGSTEEEQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgatatcacgcgcagagcagattgcccaattagagaatgagtggaaaaaagcacgt
tgggaagggatcactcgcccttatagtgctgaagaagtggtgaagctgcgtggttcagtt
aacccagaacatactctagcgaccagaggggcacaaaggttatgggatcaactccatggc
cattctaaaaaaggttatgtgaatgccttaggtgccttaacggggggacaagcattacag
caagccaaagcgggaattgaagctatttatctttctggctggcaagtggcagcggatgcg
aacacggcatcaagtatgtaccctgaccaatcgttatacccggtcgattcggttccttcg
gtcgtgaaaaagataaacaacacgttccgtcgggcggatcaaattcaatgggctaatggg
attgggccagaaaataaggaatacattgatttcttcctccctatcgttgctgatgctgaa
gcgggatttggtggggtgctaaatgcctttgaactaatgaaaggtatgattgaagcggga
gctgctgcggtacattttgaagatcagctcgcggcggttaaaaaatgtggtcatatgggt
ggaaaggtactagtaccaacccaagaggcgatacaaaagttagttgcggctcgtttagca
gcagatgtgtcgggagtaccaacgattttaatcgcgagaacggatgcagacgccgccgat
cttttaacgtcggattgcgacccgtatgatgccgaatttattacaggggaaagaaccaac
gaaggctttttccgtactaaagcgggcattgagcaagccattagccgtgggctcgcttac
gcgccatatgctgatttggtctggtgtgaaacatcaaaacctgatttagaggcggctcgc
caatttgccgaggcgatccacgcgaaatacccgggtaaattactggcttataattgctca
ccttcctttaactggaagagaaatttggacgatgcgacgattgctcgcttccaagatgag
ctttcagcgatgggttaccgcttccagtttatcacattggcgggtattcatagcatgtgg
tttaacatgtttgatttagctcatgcgtatgcacaaggtgaaggtatgaagcactacgta
gagaaagttcaggagcgtgagtttgctgcgattgataagggttataccttctcttcgcat
cagcaggaggtgggaacgggttattttgataaggtaacgactgtgatccaaggtggaaca
tcgtcagtcactgcgctgacaggttcgacggaagaagagcagttttaa

DBGET integrated database retrieval system