KEGG   Providencia stuartii: S70_09435Help
Entry
S70_09435         CDS       T02042                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psi  Providencia stuartii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S70_09435
Enzymes [BR:psi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     S70_09435
Exosome [BR:psi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S70_09435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2021472..2023679
Genome map
AA seq 735 aa AA seqDB search
MKEREKPSEQQLIIDQLFAGHYRDPFAFLGMHQQGKVTYFRVLLPNAQEVTVLDRLTAAP
VVQLSRLDERGFFSGDATDLDANFTYILQVNWGNSQQVIEDPYRFGTLLHDADTKGLQRT
FSFETLGAHVRQVGDITGTHFCVWAPNAQRVSVVGAFNFWDGRRYPMRHHPENGLWEIFL
PAIQAGTHYQYEILDAKGEVQLKSDPYAFRSQLRPDTTSIVSLLPKQRHPTAQQIQSNQR
NAPISIYEVHLGSWRRSANNHSWLTYRELAETLLPYVKEMGFTHLEILPISEHPFDGSWG
YQPLGIYSPTSRFGSPQDLIDFVDEAHRLGINVILDWVPGHFPSDNSGLANFDGTPLYEY
ADPKEGKHRDWDTLIYDYRSHEVRQFLSDNAVYWVDRFGFDGLRVDAVASMIYRDYSRPD
GEWIANEYGGNINLEAVSFLQHTNELLHRIQPNVLMAAEESTDFSGVTLPPSLGGLGFNY
KWNMGWMHDTLSYLQLDPIARKYHHNKMTFSVMYAWSENYILPLSHDEVVHGKGSLLRKM
SGSPDQKFATLRAYYGFMWAHPGKKLLFMGGEIAQWREWDHDGELDWHLVDIPTSPHAGV
QRLIRDLNVTYRSTPALYDNDHNESSFEWVIVDDHDNSVFAFIRYAENGDPLLVISHFTP
VTRADYRIGVRLHGQYQVLLNTNDSRYGGSDKHPVAPISSQPIKAHGCQYSIALTLPPLS
TLYLTIKPATKKNKE
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagagagaaaaaccatcagagcaacaactgatcatcgatcaattatttgccgga
cattatcgtgacccttttgctttccttggtatgcatcaacaaggaaaagttacctatttt
cgagtcttactcccaaatgctcaagaggtcaccgtactggataggttgaccgcagccccc
gttgtgcaactatcacgccttgatgaacgcggctttttttcaggcgatgcaacagactta
gacgctaatttcacttatattttgcaggttaactggggcaattcacaacaggttattgaa
gatccgtaccgtttcggcacattactacacgatgcagataccaaaggcctccagcgtact
ttctcatttgaaacactcggtgcgcatgtacgccaagtgggtgatattacaggtacgcat
ttttgtgtttgggcaccgaatgcccaacgagtctctgtcgtgggcgcttttaacttttgg
gacggtcgccgatacccaatgcgccatcatcccgaaaatggcctttgggaaatctttctt
cccgcgattcaggcaggtactcactatcaatatgaaatattagatgcaaaaggcgaagta
caattaaaatccgatccttatgcctttcgcagccaattacgaccagatacgacatcaatt
gtttccctgcttccaaaacagcgccaccccacagcacagcaaatccaatcgaaccaacgc
aatgcccctatctctatttatgaggttcaccttggttcatggcggcgctcagccaataac
catagttggctcacttaccgagaactggcagaaacattacttccctatgttaaagagatg
gggttcacccatttagaaatattgcctattagcgaacacccttttgatggctcatggggc
tatcagccattaggtatctactctcctaccagccgttttgggtcgccgcaagatttgatt
gactttgttgatgaagcacatcgattaggtattaatgtgatcctagattgggtgcccggc
cattttccttcggataatagtgggttagccaattttgatggtacgccactctatgagtat
gctgacccaaaagaaggtaagcaccgcgactgggatactctgatctacgactaccgcagt
cacgaggtacgccagtttttatccgataatgccgtctattgggtagatcgatttggcttc
gatggcttacgcgttgatgctgttgcatcgatgatttatcgcgattatagccgccctgac
ggcgaatggattgcaaacgagtatggtggcaatattaaccttgaggccgtcagtttctta
cagcataccaacgaattacttcaccgtatccagcctaatgtattaatggccgcagaagag
tcgacagacttctctggggtgacattgccaccatcccttggcggacttggatttaactac
aaatggaatatggggtggatgcatgacacgttaagctatttacagctagaccctatcgcc
cgtaaataccaccataataaaatgacattcagcgtgatgtatgcgtggagtgaaaactac
atattgcctctatctcacgatgaagttgttcacggtaaaggttccttattgcgcaaaatg
tcaggctcacctgaccaaaaatttgccacgctacgtgcctattatgggtttatgtgggcg
cacccaggtaaaaagctgctgtttatggggggagaaatcgcacaatggcgtgaatgggat
catgatggggagttagattggcatctggtggatattcctaccagcccgcatgcaggtgtt
caacgtctgatcagagatctcaacgttacttatcgcagtacacccgccctgtacgataac
gatcacaatgaaagtagttttgaatgggtgatcgtcgacgatcacgataattcggttttt
gcatttattcgctacgccgaaaatggcgacccgctgcttgtaatcagccatttcactcca
gtaacgcgagcagattaccgcattggtgtcaggctacacggtcaatatcaagtcttatta
aacacaaatgattcacgctatgggggcagcgataagcatcctgttgctcctatttccagc
cagccaatcaaggcacatggttgccagtattctattgcattgacgctgccaccgttatca
acgctatatctgaccataaagccagccacaaagaaaaataaggagtaa

DBGET integrated database retrieval system