KEGG   Providencia stuartii: S70_09630Help
Entry
S70_09630         CDS       T02042                                 

Definition
phosphoglucose isomerase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
psi  Providencia stuartii
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S70_09630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_09630
   00520 Amino sugar and nucleotide sugar metabolism
    S70_09630
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     S70_09630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2063980..2064690)
Genome map
AA seq 236 aa AA seqDB search
MSLTSKTSCVITISDVPTTKRILVIDVGGTHVKLYTAPNTPAIEFVSGHTMTPEQFIHDV
NQCVDTSLFDGVSIGFPSPISGNRILKEPVNLASGWVNFDLADAFPCPIRLINDAAMQAV
GSYEGGSMLFLGLGTGLGSALIVNQQLQPMEVAHLPYLEHDYEYYVSEHYRESEGDAVWR
QSVLTVVDLFYQAFMPDYIVIGGGNVHQFTTLPEHVRRGDNDKAFLGGIRIWGNNL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaacgagtaaaacatcttgtgttattacaatttcggatgttcccacaacaaag
cgaattttagtcattgatgttggtggtactcatgtcaagctatataccgcccccaacacc
cctgccattgaattcgtttctgggcacaccatgacaccagaacaatttattcatgatgtg
aatcaatgcgttgatacctctctgttcgatggcgtcagtattggctttccatctcctatc
tctggaaatcgcatccttaaggaacccgttaatttagccagtggttgggtcaactttgat
ttagccgatgcgttcccttgccctattcgcctaattaatgatgccgcaatgcaagccgtc
ggtagctatgaaggtggcagtatgttgtttttagggcttggaactggattgggaagcgca
ttgattgttaatcagcagctacagccaatggaagtcgcgcacctgccataccttgaacac
gactatgaatactatgtcagtgaacattatcgtgaatccgaaggtgatgccgtgtggcgg
cagagtgtactgacggtagtagacctcttttatcaagcatttatgccggactacattgtt
atcggtggcgggaatgtgcatcagtttacgacgttaccggaacatgtacggcgtggagat
aatgacaaagcttttcttggtggaatcagaatttggggaaataacttatga

DBGET integrated database retrieval system