KEGG   Providencia stuartii MRSN 2154: S70_10220Help
Entry
S70_10220         CDS       T02042                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    S70_10220
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     S70_10220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2191145..2192074)
Genome map
AA seq 309 aa AA seqDB search
MGAAKLVVLGSINADHILNIGQFPQPGETVRGNHYQVAFGGKGANQAVAAGRSGADITFI
ACVGNDSIGQSIKTQLKNDHIDVECIDVVDNETTGVALIFVNQQGENVIGIHAGANAHLT
KERVNHYQQKIIDADAVLMQLESPIEAVQLAAEIAQKNSTKVILNPAPAQALPDSLLALV
DIITPNETEAEHLTGITVKDDQSAQAAAQVLHDKGISKVMITLGARGVWYSEKGSTGKII
AGFKVKAVDTIAAGDTFNGAYVTALLEGKSDAEAIVFAHAAAAIAVTRPGAQPSVPWRNE
IDAFLTQQE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcagctaaacttgtggttttaggtagtatcaatgctgatcatattctaaacatc
gggcaatttccgcaaccgggagaaacggttagagggaatcactatcaggttgcttttggt
ggtaaaggtgcgaatcaggcggttgctgctggacgaagtggtgctgacataacatttatt
gcttgcgtcggtaacgatagcattgggcaaagcatcaaaacgcagctcaaaaatgatcat
attgatgttgaatgtattgatgtcgttgataatgaaacaacgggtgttgcactgattttt
gtaaaccaacaaggtgaaaacgtaattggtatccatgctggagccaatgcgcatttaact
aaagaaagagtgaaccactatcagcaaaaaatcattgatgcagatgccgtactgatgcaa
ttagaatcccctattgaagcggttcagttagcagcggaaattgcacaaaaaaacagtaca
aaagtcatcttaaaccctgcacctgcccaagctcttcctgactcgttacttgctttagtc
gatattattacgccaaatgaaacagaagcggagcatttgactggaattaccgtcaaagat
gatcagagcgcacaagcggcagctcaagtattgcatgataaaggtatcagtaaagtcatg
attacgttaggggcgagaggcgtttggtatagtgaaaaaggttcaacaggtaaaattatc
gctggatttaaagtgaaagccgtcgatacaattgcggcaggggatacctttaatggcgct
tatgttaccgctttacttgaagggaaaagtgatgctgaggctattgttttcgctcatgca
gcggctgcaattgcggtaactcgacccggtgcacaaccctctgtaccatggcgcaatgaa
atcgatgcatttttaactcaacaggaatag

DBGET integrated database retrieval system