KEGG   Providencia stuartii MRSN 2154: S70_10815Help
Entry
S70_10815         CDS       T02042                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:psi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    S70_10815
Enzymes [BR:psi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     S70_10815
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     S70_10815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2320626..2321435
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGNSIQYAIVRNSRLRWPVSEQIKSLSDEMILSVQRRAKYLL
IELKNGWIIIHLGMSGSLRILLEELPEEKHDHVDLVLKDGKVLRYTDPRRFGAWLWCDDL
ETSRVLSHLGPEPLSDEFNAQYLFEQAGKRKIAIKPWLMDNKVVVGVGNIYANEALFAAG
ISPEKITHTLTLEQSIDLVQQIKKVLQRSIEQGGTTLKDFLQSDGKPGYFAQELFVYGKK
GEPCLICGTPILSIKQGQRSTFYCPQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactacccgaggttgaaaccagtcgtagagggatagaaccacatcttgttggt
aactcaattcagtatgcaattgttcgtaacagccgcttacgttggcctgtatcagagcaa
attaaaagtttatctgatgaaatgattttaagtgtacaaaggcgcgctaagtatctgtta
atcgaactaaaaaatggttggattattatccacttaggcatgtcgggtagtctgcgtata
ttgttggaagaattgcctgaagaaaaacatgaccatgttgatttggtattaaaagatggc
aaagtactacggtacacggatcctcggcgctttggtgcgtggttatggtgtgatgatctt
gaaacgagtcgtgttttatcccatctaggcccagaacctctttctgatgaatttaatgct
caatatttatttgagcaggcaggaaagcgaaaaatagccattaaaccttggctgatggat
aacaaggttgtagtgggtgttggtaatatttatgctaatgaagcactatttgcggcgggc
atttcaccagaaaaaatcacgcacacattgactcttgaacaatcgattgatttggtccag
cagatcaaaaaggtactgcagcgctctattgagcagggtggaaccacgctgaaagatttt
ctacaatccgatgggaaaccagggtacttcgcccaagaattgtttgtatatggtaaaaaa
ggtgagccttgtttgatatgtggcacgccaattcttagtatcaaacaaggccaacgcagt
accttttattgtcctcaatgtcaaaaataa

DBGET integrated database retrieval system