KEGG   Providencia stuartii: S70_10815Help
Entry
S70_10815         CDS       T02042                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
psi  Providencia stuartii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:psi03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2320626..2321435
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGNSIQYAIVRNSRLRWPVSEQIKSLSDEMILSVQRRAKYLL
IELKNGWIIIHLGMSGSLRILLEELPEEKHDHVDLVLKDGKVLRYTDPRRFGAWLWCDDL
ETSRVLSHLGPEPLSDEFNAQYLFEQAGKRKIAIKPWLMDNKVVVGVGNIYANEALFAAG
ISPEKITHTLTLEQSIDLVQQIKKVLQRSIEQGGTTLKDFLQSDGKPGYFAQELFVYGKK
GEPCLICGTPILSIKQGQRSTFYCPQCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactacccgaggttgaaaccagtcgtagagggatagaaccacatcttgttggt
aactcaattcagtatgcaattgttcgtaacagccgcttacgttggcctgtatcagagcaa
attaaaagtttatctgatgaaatgattttaagtgtacaaaggcgcgctaagtatctgtta
atcgaactaaaaaatggttggattattatccacttaggcatgtcgggtagtctgcgtata
ttgttggaagaattgcctgaagaaaaacatgaccatgttgatttggtattaaaagatggc
aaagtactacggtacacggatcctcggcgctttggtgcgtggttatggtgtgatgatctt
gaaacgagtcgtgttttatcccatctaggcccagaacctctttctgatgaatttaatgct
caatatttatttgagcaggcaggaaagcgaaaaatagccattaaaccttggctgatggat
aacaaggttgtagtgggtgttggtaatatttatgctaatgaagcactatttgcggcgggc
atttcaccagaaaaaatcacgcacacattgactcttgaacaatcgattgatttggtccag
cagatcaaaaaggtactgcagcgctctattgagcagggtggaaccacgctgaaagatttt
ctacaatccgatgggaaaccagggtacttcgcccaagaattgtttgtatatggtaaaaaa
ggtgagccttgtttgatatgtggcacgccaattcttagtatcaaacaaggccaacgcagt
accttttattgtcctcaatgtcaaaaataa

DBGET integrated database retrieval system