KEGG   Providencia stuartii MRSN 2154: S70_11040Help
Entry
S70_11040         CDS       T02042                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    S70_11040
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    S70_11040
Enzymes [BR:psi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     S70_11040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2365678..2367558)
Genome map
AA seq 626 aa AA seqDB search
MKNLTLLSLCLLSAMSLADPLSQTQLNELWKDKQKSADEIVKNMSEAEKIGQLFMLDFRY
WNKDSKGEPAPFLAMNDEVAKVINQYHLGSVILFRENLIDTPQTVELINQLQASRSNLPL
FIGTDQEGGYVTRLRVGTEMPGNMALGATRNPALAELTGMIHGYELSSLGFNINFGPVVD
VNNNQNNPVIGVRSYSDNKELVEALSTNYIKGIHKYNLLTSLKHFPGHGNVSSDSHVDLP
VVNSDAKAWRSTELPPFQYALSHGADAVMTAHIIVPALDNNKIKTLSGKEVDTPATLSKP
ILHGVLRDELKYNGLIITDAMDMGAIADNFDMNWAVETSLLAGSDIILMPIKMWDSEAVT
RLDNMYRHLESEAKKNPELRKRIDESAKRVVLKKLQQEITAQPVDLNNAQLVVASKSHKD
LENMVSEQAITLIKNDNILPYVLKPQNRILVISDENPRNTLIQKHLNDIANETGVAIESQ
TAMIKLAENTLSAKEVQSLLKGQDLVLLTTYNLKDNPANAQLVVNEANKENIPVVVISSR
NPYDIAYLKGVKANIAIYGITGFDITNNNRNSLETNIRSGLRTLFANPQAQPLNPPKGLL
PVNIKNPQGNKILFPYGHGETYNTTH
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctgactctactttctctgtgcttactcagtgcaatgtcgttagccgacccc
ctttcgcaaacacaactcaacgaattgtggaaagataaacaaaaatcggctgatgaaatt
gtgaaaaacatgtctgaagctgaaaaaatcggccaactttttatgttggatttccgttat
tggaataaagacagcaaaggcgagcctgcaccatttctagcgatgaatgacgaagtcgct
aaggtcattaatcaataccatttaggctctgtcattttattccgtgaaaaccttattgat
accccacaaaccgttgaattaattaatcaactacaagcctcacggagtaatttgccactc
tttattggtactgaccaagaaggcggctatgtgactcgcctccgtgtcggcaccgaaatg
cctggcaatatggcattaggggcaacacgtaacccagctctagcggaattgacgggtatg
atccatggctatgaattatctagccttggctttaatatcaattttggccccgttgttgat
gtcaataacaaccaaaacaaccctgtcattggtgtccgctcttactccgacaacaaagag
cttgttgaagcgctatcaaccaattacatcaaagggatccacaaatataatttattgacc
tcactgaaacacttccccggacacggtaatgtttcctctgactctcatgtcgacttaccc
gtagtgaattccgatgctaaagcttggcgctccacagaattaccgccgttccaatatgcg
ctgagtcatggtgctgatgcggtaatgacagcacacattattgtgcctgcattagataac
aacaaaatcaaaacattatcaggaaaagaggttgacactcctgccacgctttccaagccg
atcctgcacggtgttttacgtgatgaactcaaatacaacggtcttatcatcaccgatgct
atggatatgggagcaatcgctgataactttgatatgaactgggcagtggaaacgtcactg
ttagcaggctccgatattatccttatgccaatcaaaatgtgggatagcgaagcggtaaca
cgcttagacaatatgtatcgccaccttgagagcgaagccaagaaaaatcctgagttaagg
aaacggattgatgagtcggcaaaacgtgtcgtgctgaaaaagttacagcaggagatcacc
gcacagcctgttgatttaaacaatgctcaacttgttgtcgcctcaaagagccataaagac
ttagaaaatatggtttccgagcaagctatcacactgattaaaaacgataatattctacct
tatgttctcaaaccacaaaatcgcattctggtgatttctgatgaaaacccacgtaacaca
ttaattcaaaagcacttaaatgatattgctaatgaaacgggtgtcgcgattgagagccaa
actgcaatgatcaaactggctgaaaatacgcttagcgcaaaagaggttcaatcgctttta
aaaggccaagatctcgtattactgacgacgtataacctaaaagataaccctgctaatgca
cagttggtggttaatgaagctaacaaagagaatattccggttgtcgttatttcatcacgt
aacccatatgacatcgcttacctaaaaggcgtcaaagcgaatatcgctatctacggtatt
acagggtttgatatcaccaataacaaccgtaattcactggaaaccaacattcgtagtgga
ttacgtacgctatttgcaaatccacaggcacaacctctaaatccaccaaaagggctatta
cccgttaacatcaaaaatccacaaggtaacaaaattctgttcccttatggtcacggtgaa
acctacaacacgactcactaa

DBGET integrated database retrieval system