KEGG   Providencia stuartii MRSN 2154: S70_11055Help
Entry
S70_11055         CDS       T02042                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00010  Glycolysis / Gluconeogenesis
psi00051  Fructose and mannose metabolism
psi00562  Inositol phosphate metabolism
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
psi01200  Carbon metabolism
psi01230  Biosynthesis of amino acids
Module
psi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psi_M00002  Glycolysis, core module involving three-carbon compounds
psi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_11055
   00051 Fructose and mannose metabolism
    S70_11055
   00562 Inositol phosphate metabolism
    S70_11055
Enzymes [BR:psi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     S70_11055
Exosome [BR:psi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   S70_11055
  Exosomal proteins of bladder cancer cells
   S70_11055
  Exosomal proteins of melanoma cells
   S70_11055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFH94062
UniProt: A0A140NQ37
Position
complement(2369403..2370173)
Genome map
AA seq 256 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNDLIAGLRNELSSVDGCDVAIAPPAIYLTQAKHALAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKEQG
LVPVLCIGESEAENEAGKTEEVCARQIDAVLNTLGAQAFQDAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAVAAQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKKTK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattggtaatgggtaactggaaactgaacggcagcactcacatggttaat
gacctgattgctggcctacgcaacgagctgagcagtgttgatggctgtgacgtggcaatt
gcgccaccggctatttatctgactcaagcaaaacatgcgcttgcaggtagccgtatcgcc
ctaggtgcacagaacgttgacgtcaatctttccggcgcatttactggtgaaacatctgcc
gaaatgctcaaagatatcggcgcaaaatacattattatcggtcactcagagcgtcgcacc
taccacaaagaaagcgatgagtttattgctaaaaaatttgctgtattgaaagagcaaggc
ttggttcctgttctttgtatcggtgaaagcgaagcagaaaatgaagcaggtaaaacagaa
gaagtgtgcgctcgccaaatcgacgctgtactcaatacactaggcgcccaagcattccaa
gatgcggtcatcgcttatgaaccaatttgggctatcggtacaggtaaatcagcgacgcca
gctcaggctcaagctgttcataaatttatccgtgaccatattgcgaaaaaagatgctgcg
gttgctgcgcaagtcatcatccaatacggtggttcagtcaatgcaggcaatgcagcagag
ctattcactcaaccagatatcgatggtgcacttgttggtggcgcatcacttaaagcagat
gcgtttgctgttatcgttaaagcagctgctgaagctaaaaaaaccaaataa

DBGET integrated database retrieval system