KEGG   Providencia stuartii MRSN 2154: S70_11725Help
Entry
S70_11725         CDS       T02042                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    S70_11725
Enzymes [BR:psi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     S70_11725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2517477..2518232)
Genome map
AA seq 251 aa AA seqDB search
MKILVTRPEPAGSELVAAIKAKGAEAFALPLIQVGPGAELDLLGSRLQQLTQNDLVFLLS
KNAVWYADLTLKQAGRNWSDKLSYYGIGRSTGQYFEALTNKMIRWPEHGETSEALLSLPE
LQFLEGKRALLLRGNGGRELLASTLRSRGAQVEYCECYTRHPVLYDKAEFNQQWVNKGIT
DIVISSGQMLALLNELIAENTKAWWFNRRLLVVSERIADQARQIGWQQVCVANSADNNAL
LEALLSTDMGC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattagtcactcggccggagcctgctggctctgagcttgttgctgccatcaaa
gcaaaaggggcagaagcattcgctttgccacttattcaggtggggccgggggctgaatta
gacttactcggatcacgccttcaacagctcactcaaaatgatttagtttttcttttatct
aaaaatgcggtctggtatgcagatttaacccttaaacaagcaggacgcaactggtcagat
aagttatcctattatgggatcggtcgttcaactggtcagtattttgaggcgctaacaaac
aaaatgatccgctggcctgagcatggcgaaaccagcgaagcattgctaagccttcctgaa
ttacagtttcttgaagggaaacgtgcgctgctcttacggggtaatggtggtagggaactc
ctcgcctctacgttacggtctaggggagcgcaggtggaatattgcgaatgttatacaaga
caccctgttttgtatgataaagcagagtttaatcaacaatgggttaataagggcattaca
gatattgttatcagtagtggtcaaatgttagccttattaaatgaattgatcgctgaaaat
acaaaagcatggtggtttaatcgccgtttattggttgtcagcgaacggattgcagaccaa
gctcgccaaattggctggcaacaggtctgtgtggcaaatagcgcagataataatgcttta
ttagaagcattactctcaaccgacatgggatgctaa

DBGET integrated database retrieval system