KEGG   Providencia stuartii: S70_11825Help
Entry
S70_11825         CDS       T02042                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
psi  Providencia stuartii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    S70_11825
Enzymes [BR:psi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     S70_11825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2541425..2542420
Genome map
AA seq 331 aa AA seqDB search
MTPEKLKENWLNRETQFSAFANGPLLDFWLRREEAEFLGVDDVPIRYVRFTHSLNNKAVV
ISPGRSESYMKYPEVAYDFYHLGFDVFIIDHRGQGRSGRMLDDPQKGHVEKFTDYIDDFA
KFVELEVQCRHYLKCYALAHSMGSAILGGYLLRDNVTFDAAAFCAPMIGINLPIPHWLAS
FIVDRAELHRSVRNDYAISTGKWQPLPYLINVLTHSQERYRRYLRYYADYPELRLGGPTY
HWLKESFAIGDELIARAGEIDVPLLVLEASEDKVVSNRELQAFCQSRQKAQTGREEKLPL
VIEGAHHEILFEVDALRAMALNAICDFFEQY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccccagaaaagctgaaagaaaattggttaaaccgagaaactcaattttctgcattt
gctaacggtccacttttagacttttggttgcgcagagaagaagccgaatttctaggggtc
gatgatgttcctattcgctatgttcgttttacccattccctaaataataaagccgttgtt
atctctcctggtcgtagcgaaagctatatgaaatacccagaagttgcctatgacttttat
cacctcggtttcgatgtctttattattgaccatcgagggcaggggcgctccggacgtatg
ttggatgatccacaaaaaggccacgttgaaaagtttactgactatattgatgattttgca
aagtttgttgaacttgaagtgcaatgtcggcattatctcaaatgttatgcattagctcac
tcaatggggagtgcgatcctcggcggctatttattacgggataatgtcacctttgatgca
gcggcgttttgcgcccctatgattgggattaatttaccgatcccacactggttagcgagc
tttattgttgatcgggcggagctacaccgcagtgtgcgtaatgactatgcgatttcaacg
gggaaatggcagccgttgccttatttgatcaatgtgttgactcacagtcaggaacgttac
cggcgttatctccgctattatgcggattatcccgaattgcggctaggtggccctacctat
cattggttaaaagaaagttttgcaattggcgatgagctaattgcccgggcgggagaaatt
gatgtaccactgttggtgttagaagcaagtgaagataaagtggtcagcaatcgagagcta
caggctttttgtcaaagtcggcaaaaagcacagacaggaagagaagaaaaattacccctc
gtgattgaaggggcacaccacgaaatcctgtttgaagtggatgcattaagagcgatggcg
cttaatgctatctgtgatttttttgagcagtattag

DBGET integrated database retrieval system