KEGG   Providencia stuartii: S70_11985Help
Entry
S70_11985         CDS       T02042                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psi  Providencia stuartii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:psi00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2575508..2576248
Genome map
AA seq 246 aa AA seqDB search
MLKQICELAIDAGSAIMEIYHAQEPLQVEQKSDKSPVTAADIAAHQIITAGLTRIAPDIP
QLSEEDPPSWNERKGWQRYWLVDPLDGTKEFIHRNGDFTVNIALIEKGMPVMGVIYAPAK
GLLYYAEGNQAWKEEGGHKQSIHVKDITPPIIAISRSHQDAELRDYLAQLGNHDTVEIGS
SLKFCLVAEGKAQLYPRFGPTNIWDTAAGHAIAMAAGAKVLDWNGKTLDYTPRESFLNPG
FRVTLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaacaaatttgtgaactggctatcgatgcaggctctgccattatggagatctat
catgctcaagaaccgctacaagttgagcaaaaaagcgataaatctccggtgacggctgcg
gatattgccgctcatcaaattattacagcgggtttgactcgcattgcaccggatattcct
cagttatctgaagaagaccccccttcatggaatgaacgcaaaggttggcaacggtattgg
ttggttgatccacttgatggcacaaaagaatttattcatcgtaatggggattttaccgtt
aacattgccttgattgaaaagggtatgcccgttatgggggttatttatgcgcccgccaaa
ggcttgctctattatgcggagggtaatcaagcgtggaaagaagagggtgggcataaacag
tcaatccatgttaaagatataacacctccaatcatagcgattagccgctctcatcaagac
gctgaattacgtgattaccttgcacaattggggaaccatgacacggtagaaattggctca
tcattaaaattttgcttggtagcggaagggaaagcgcagctctatcctcgctttgggcca
actaacatttgggatacagcagcagggcatgcaatcgcaatggcagctggggctaaggtg
cttgattggaatggcaaaacattagattacacaccacgtgaatcctttttaaacccaggt
tttcgcgtaacgttattttaa

DBGET integrated database retrieval system