KEGG   Providencia stuartii MRSN 2154: S70_12145Help
Entry
S70_12145         CDS       T02042                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    S70_12145 (folP)
Enzymes [BR:psi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     S70_12145 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2608108..2608956
Genome map
AA seq 282 aa AA seqDB search
MKIRARACELDLSTPKVMGILNVTPDSFSDGGTHNRYHDALEHAAKMVNEGASIIDIGGE
STRPGAAEVSVNEELDRVIPIVEAIAQRFDVWISVDTSKAEVMSEAAKAGMHLINDIRSL
HEPGAIEVAAQSGLPVCIMHMQGQPRTMQDAPNYENVVADIKAYFDAEIARCVAAGIDKQ
QIILDPGFGFGKNLSHNYQLLANLDQFHDFGLPLLAGMSRKSMIGNLLNVPPQERLVGSI
ACATIAAMQGAQIIRVHDVKETVQAMQIVQMTLSEKEKLAYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagagcaagggcttgtgaactcgatctatccacaccaaaagtgatggggatt
ttgaatgttactcctgattcattttcagatggtggcactcataatcgttatcatgacgca
ttggaacatgccgctaagatggtgaatgaaggggcatcgattattgatattggcggtgaa
tcgacgcgtccgggagcggcagaggtttctgtcaatgaagaactcgatagagttattcca
attgtggaagccattgcacagcgttttgatgtgtggatttctgttgatacctcaaaagcg
gaagtgatgtcagaagccgcaaaagcaggtatgcacctaatcaatgatattcgctcatta
catgagccaggagccattgaagttgcggcacaaagtggcttacccgtttgtattatgcat
atgcaaggtcagccaagaaccatgcaagatgcgcctaattatgaaaatgttgtagcagat
attaaagcttattttgatgctgaaattgcgcgttgtgtcgcggcaggtatcgataaacag
cagataatactcgatcccggttttggttttggtaaaaacctgtcacataattatcaactg
ttggcaaatttggatcagtttcatgatttcggactaccgctattggcaggaatgtctcgt
aaatctatgattggaaacttattgaatgttccaccacaagaaaggcttgtgggaagtatt
gcttgcgcaactatcgcagcgatgcaaggcgcacagattattcgtgtacatgatgtcaaa
gagaccgtacaagcaatgcagatcgttcagatgactctgtcagaaaaggaaaagttagcg
tatgagtaa

DBGET integrated database retrieval system