KEGG   Providencia stuartii MRSN 2154: S70_14125Help
Entry
S70_14125         CDS       T02042                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    S70_14125
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    S70_14125
Enzymes [BR:psi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     S70_14125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2994757..2996019
Genome map
AA seq 420 aa AA seqDB search
MDKFLVKGPTRLEGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLRDIDTTIKLLNQL
GTKVERNGSIYVDARNVTEYCAPYDLVKTMRASIWALAPLVARFGHGEVSLPGGCAIGAR
PVDLHISGLEQLGAHIILEDGYVKATVDGRLKGACIVMDKVSVGATVTIMTAATLAEGTT
TIENAAREPEIEDTANFLNTLGAKITGAGTDRIVIEGVERLGGGTYRVLPDRIETGTFLI
AAAVSKGKVVCRNARPDTLDAVLAKLREAGAKIEVGEDWISLDMQGKRPKAVTLRTAPHP
GFPTDMQAQFSLLNLVAEGAGMITETIFENRFMHIPELIRMGAHAEIESNTVLCHGVEKL
TGAQVMATDLRASASLVIAGCIAEGTTTVDRIYHIDRGYEHIEDKLRGLGANIERIKSDD
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttttagttaaagggcctacccgcttagaaggtgaggtaacaatttctggt
gcgaaaaatgccgcattaccaattctgttcgctgcgctgttggctgaagagccggtagag
atccaaaatgtacctaagcttagggatatcgatacaacgattaagttgctgaatcaactc
ggaacgaaagttgaacgtaatggttccatttatgttgatgccagaaatgtcactgaatac
tgtgcaccttatgatctggtcaaaaccatgcgtgcttccatttgggctctcgcaccgcta
gtcgctcgttttggtcacggggaagtttctttaccgggaggctgcgcgattggcgctcgt
cctgttgacctacatatctcaggcttagagcagctcggcgcgcacattatcctagaagac
ggctatgtgaaagcgacggttgatgggcgtttaaaaggcgcttgtattgtcatggataaa
gtgagtgttggcgctacggtgactattatgaccgcggcaacattagctgagggcacgaca
actattgagaatgccgctcgcgagccagaaattgaagatacggctaatttcttaaataca
ttaggtgccaaaattaccggtgctggtactgaccgcattgttattgaaggggttgagcgc
ctaggtggtggtacctatcgtgtactgcctgatcgtattgaaacaggtactttccttatt
gcagcagcagtttcaaaagggaaagtggtttgccgtaacgctcgtccagatacactagat
gccgttttggcgaagctgcgcgaagcaggtgctaaaattgaggtaggcgaagattggatc
agtcttgatatgcaaggcaaacgccctaaagcggttactttgcgtactgcaccgcatcct
ggcttcccaacagatatgcaggctcaatttagcctattgaatttagtggctgagggtgca
gggatgatcacagaaacaatttttgaaaatcgtttcatgcatattcctgaattaattcgt
atgggcgcgcatgctgaaatcgaaagtaatactgtgttatgccatggtgtggaaaagcta
actggagcacaagtcatggcgacagatttgcgtgcatcagcaagcttagtcattgcaggt
tgtatcgcggaaggtactacaacggttgatcgtatctatcatatcgaccgcggatatgag
catattgaagataagctgcgtggtttaggcgcgaatatcgaacggatcaaatctgacgat
taa

DBGET integrated database retrieval system