KEGG   Providencia stuartii MRSN 2154: S70_14900Help
Entry
S70_14900         CDS       T02042                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    S70_14900 (recD)
Enzymes [BR:psi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     S70_14900 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3168963..3170822
Genome map
AA seq 619 aa AA seqDB search
MMKALFNKALEARLFTPLDIQFAYNITQEQNPTLLLLTALLSAETMAGHVCLSLSDFSQE
KLFAGRHPELADEFWHAIGTPDPETIYHLVKNAPFVCLAGESELSPLVLSGEFLYFQRLW
QYEQSVSDYFSHTGLPQYDAQRIKGILDALFPQSDEIDWQKIAAAVAVTSRVSVISGGPG
TGKTTTVARILAALVKLAVENKQRIQIELAAPTGKAAARLTESLGAALDGLSLTDEERHM
LPNQAKTLHRLLGAQPESQQFRYHRDNLLTLDILIVDEASMVDLPMMGKLIEALPVNAKL
IFLGDKDQLASVEAGAVLGDICQFADQGYSPQRAQELAQLTGYALDHFTSNTGPLIRDSL
CLLRKSYRFSASSGIGQLAFAVNDGDTKRAEKLLNSTLNDVHTYLQESEDDYAQMLIAAS
NFYRDYLLSVKARQDPAEILFKFNQFRLLTALRDGPYGVTGINEKLEKLLHRQGLIHRPL
NQINKHYAGRPIMISRNDSPLGLFNGDIGIILPDEEGALRAYFQYPDGSIKGIQPNRLPL
HETAYAMTVHKSQGSEFAHTALVLPKVYSPVVTRELVYTAITRAKKELSLYCTIKILRRA
IETPTKRRSGLAIQLMNVK
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcgctgtttaataaagcgctcgaagcgcgattattcactccccttgatatc
cagtttgcttataacattacacaagagcaaaacccaacattattactgcttaccgcatta
ttgagtgctgagacgatggcggggcatgtctgcttgtcattatctgatttcagtcaggaa
aaactgtttgcagggcgccatcctgaacttgcagacgaattttggcacgcaataggcaca
cctgatccagaaaccatttatcacctagttaaaaacgccccttttgtctgcctagcgggg
gaaagtgaattatcccccttggtgttatcgggggagtttttatattttcagcggctatgg
caatatgagcaaagtgtttcagactacttttcacacaccggactacctcaatatgatgct
cagcgcattaaaggaatattagacgctcttttcccgcaaagtgatgaaattgactggcaa
aaaatagctgccgcagtggctgtcactagccgagtttccgtgatttcaggggggcctggc
acggggaaaacaaccacagttgctcgaattttagcggcattggttaaattggctgtagag
aataaacaacgtattcaaattgaattagcagcgccgacaggtaaagctgcggcacgttta
acagagtcgttgggggcagcactcgatggcttgtcattgaccgatgaagagcgacatatg
ttgcctaatcaggcaaaaacactgcataggctattaggggcacaacctgaaagccagcaa
ttccgctatcaccgtgataatttattaacactggatattttgattgttgacgaggcttcc
atggtggatttacccatgatgggtaaattaatcgaagccttgccagtaaatgccaaattg
atctttttaggggataaagatcaattagcatccgtcgaagcgggggctgtacttggagat
atttgccaatttgcggatcaaggatatagccctcaacgtgcccaagaattggctcaactg
acaggatacgcactcgatcactttacatcaaatacaggccctttgatcagagatagcctc
tgcctactgcgtaaaagttaccgtttttcggcttcttcgggtatcgggcagcttgctttt
gcggttaatgatggagataccaagcgtgctgaaaagttattaaacagcacattaaatgac
gtgcatacttatttacaagaaagtgaggatgattatgcacagatgttgatagcggcatct
aatttctatcgagattatcttctatcagtaaaagctagacaggatccggctgagatttta
tttaaatttaatcaatttcgtttgttgacagctttgagagatggcccctatggtgtaaca
gggataaacgaaaaattagaaaaactgcttcatcggcaggggcttattcatcggccatta
aaccaaataaataaacattatgcaggtaggccaattatgatcagccgaaatgatagtcca
ttagggctatttaatggcgatatagggataatcctgcctgatgaagaaggggcacttaga
gcttattttcagtatcccgatggctcaattaaggggatccaacctaatcggttgccttta
catgaaacagcatatgcaatgactgtacataaatcacaaggttcagagtttgctcatacc
gccttagtactaccgaaggtatattcaccagtcgtcactcgagagcttgtgtatactgca
ataactcgcgccaaaaaagaactttctttgtattgcacgattaagattttacgccgtgcc
attgagacaccgacgaaacgacgtagtggcttagcaatacagctcatgaatgtaaaataa

DBGET integrated database retrieval system