KEGG   Providencia stuartii: S70_15765Help
Entry
S70_15765         CDS       T02042                                 

Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psi  Providencia stuartii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S70_15765
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    S70_15765
  Amino acid metabolism
   00310 Lysine degradation
    S70_15765
Enzymes [BR:psi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     S70_15765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3350055..3351269
Genome map
AA seq 404 aa AA seqDB search
MSSVEILVPDLPESVADATVATWHKKPGDSVERDEVLVEIETDKVVLEVPASEAGVLEAI
VEDEGATVLSKQLLGRIRLGDSTGMPADVKPAQEAAPAQRQTASLEEESNDALSPAIRRL
VAEHDLNPADIKGTGVGGRLTREDVEKHLAANKSAPAAKAQAPAAPQAPLAHRSEKRVPM
TRLRKRIAERLLEAKNSTAMLTTFNEVNMQPIKDLRKQYGEAFEKRHGVRLGFMSFYIKA
AVEALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDVDAMSMADIEKTIKE
LAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGK
VEILPMMYLALSYDHRLIDGKESVGFLVAIKDMLEDPTRLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgtagaaattcttgttccagatcttcctgaatccgttgctgatgctacggtt
gccacatggcataaaaaaccaggtgatagcgttgaacgtgacgaagtgctggttgaaatc
gaaacggataaagttgtactagaagttcctgcaagtgaagcgggtgtactagaagctatc
gttgaagacgaaggtgcaacagtgttatctaaacaactgttaggccgtattcgtttgggt
gatagcactggcatgccagcggatgtgaaacctgctcaagaagctgcacctgcacaacgt
caaacggcgagcttggaagaagagagcaatgatgcactgtctccagcgatccgtcgctta
gttgcagagcatgatcttaacccagcagatattaaaggcacgggtgttggtggtcgtctg
actcgcgaagatgttgaaaaacatttagcagcgaacaaatcagcgcctgctgctaaagca
caagcacctgctgctccacaagcgccactggcacatcgtagcgaaaaacgtgtaccaatg
acacgtctgcgtaaacgtattgctgagcgtctgttggaagcgaaaaacagcactgcgatg
ttaacaacctttaacgaagttaacatgcagccaatcaaagatctgcgtaagcaatatggt
gaagcgttcgaaaaacgtcacggtgtgcgtttaggctttatgtctttctacattaaagca
gcggtcgaagcactgaaacgttatccagaagtgaatgcttctattgacggtacagatgtg
gtttaccacaactatttcgacatcagtattgcggtatcgacacctcgtggtctggtaaca
ccagtattgcgtgacgttgatgcgatgagcatggctgatatcgagaagacaattaaagaa
ctggctgttaaaggtcgcgacggtaaattaacggttgaagacttaactggtggtaacttc
actatcactaatggcggcgtatttggttctctcatgtccacacctatcattaacccacca
caaagtgcaatcttaggcatgcatgctattaaagatcgccctatggcggttaatggtaag
gtcgaaattcttccaatgatgtaccttgcattatcttatgaccaccgcctaattgatggt
aaagagtcagttggcttcttagtggctatcaaagatatgctggaagatccaactcgttta
ctgctggacgtatag

DBGET integrated database retrieval system