KEGG   Providencia stuartii MRSN 2154: S70_16140Help
Entry
S70_16140         CDS       T02042                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    S70_16140 (folE)
Enzymes [BR:psi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     S70_16140 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3425196..3425855
Genome map
AA seq 219 aa AA seqDB search
MSSLSKEAELVHAALEARGLETPLRIQPKSGEERKQLIEGHMTEIMKLLNLDLTDDSLAD
TPKRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDKVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLDTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctctgagtaaagaagccgaattggtgcatgctgctttggaagcaagagggctt
gaaaccccgttgcgtatccaaccaaaatcaggcgaagagcgtaagcaactgattgaaggg
catatgacagagatcatgaagttactgaatttggacttaactgacgatagcttggcggat
acaccaaagcgcatcgctaaaatgtatgtcgatgaaattttttcaggtctagattacgcg
aacttcccaaaaatcaccgtcattgaaaataaaatgaaagttgatgagatggtcactgtg
cgtgatattaccttaacaagtacatgtgaacaccattttgtcactattgatggtaaggct
acagttgcttatattccgaaagataaagtgattggcctgtcaaaaatcaaccgtattgtt
caatttttctcacaacgtcctcaagtacaagaacgcttaactcagcagattttggtggcc
ttgcagacattgctagatactaataatgttgcggtatcaattgatgctgtgcattactgt
gttaaagctcggggtatccgtgatgcgaccagtgccaccaccactacttcgttgggtgga
ctgtttaaatctagtcaaaacacacgtcaagagtttttgcgcgcagtgcgtcacctgtaa

DBGET integrated database retrieval system