KEGG   Providencia stuartii MRSN 2154: S70_16335Help
Entry
S70_16335         CDS       T02042                                 

Definition
bifunctional HisD: L-histidinal:NAD+ dehydrogenase/L-histidinol:NAD+ dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    S70_16335
  Amino acid metabolism
   00340 Histidine metabolism
    S70_16335
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     S70_16335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3465016..3466320)
Genome map
AA seq 434 aa AA seqDB search
MGFNQPIRWSSCHANEQKALLTRPAIAASTNISAAVTQIIEQVKARGDSALIEFSQRFDK
TAISTIRVSQDAVEQAATRLDDNIKIAMQTAIGNIRRFHEAQKPAAIQVETQPGVVCQQI
TRPIDSVGLYIPGGSAPLLSTVMMLGTPANIAGCRQVILCSPPPIADEILYAAKLCGITD
IFQVGGAQAIAAMAFGTESIPAVDKIFGPGNAYVTEAKRQVSQDHEGAAIDMPAGPSEVL
VIADSQANPAFTAADLLSQAEHGPDSQVILLTDSQTFAQRVIDETEKQLAELSRADIARA
ALSASRVIIADSIAQCVEISNRYGPEHLILQTRNADELVEDITSAGSIFVGDWSPESAGD
YASGTNHVLPTYGYTSTYSSLGLADFMKRMTVQKLSPQGLLGLATTIETLAQAESLTAHK
NAVTLRVTELNKQK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgggatttaatcaaccgattcgctggtcatcatgtcatgctaatgaacaaaaagcgcta
ctgacacgccctgccatcgctgcgtctacaaacattagcgctgctgtcacccagatcatt
gaacaggtcaaagcccgcggtgatagtgcattaatcgaatttagccaacgttttgataaa
acagctatttcaactattcgtgtttcacaagatgctgttgaacaagccgcaacacgcctt
gatgacaacatcaaaattgcgatgcaaacggccatcggcaatatccgtcgttttcatgag
gctcagaaaccggcggctattcaagttgaaactcaacctggggttgtgtgccaacaaatt
acacgcccgatcgattccgtgggtctctatattcctggaggctcggccccccttctttca
acggtaatgatgttaggcacacccgcaaatattgcaggctgccggcaagtgatcctttgc
tcaccgccacctattgcagatgaaatactctatgccgctaaattgtgtggtattaccgat
attttccaagttgggggagcgcaagcaattgccgctatggcatttggaaccgaaagtatt
cccgccgttgataaaatttttggcccgggcaatgcctatgtgacagaggccaaacgccaa
gtcagccaagatcacgaaggggccgcaattgatatgccagcggggccatcagaagtgtta
gtcattgctgacagccaagccaaccctgcttttacagcggcggatctattatcgcaagca
gagcatggccctgattcacaagtcatattgttaaccgacagccaaacatttgctcaacgt
gttattgatgaaacggaaaaacagcttgcagagctatcgcgtgctgatattgcaagagca
gcattgagtgccagtcgtgtcattattgctgactccattgcacagtgcgttgaaataagt
aaccgctacggtccagaacatttaattctacaaacacgtaatgccgacgaattagtcgaa
gacatcaccagtgcgggatcgatttttgttggtgactggtcacctgaatccgcgggagat
tatgcatctggaactaaccacgtgttgccgacttacggttatacatcaacctattcaagt
cttggccttgctgattttatgaaacgtatgacagtgcaaaaactctcgcctcaagggctt
ctagggttagcgactaccattgaaacgttagcgcaagcagaaagcctaacggctcacaaa
aatgccgtgaccttacgtgtcactgaactgaacaaacaaaaatag

DBGET integrated database retrieval system