KEGG   Providencia stuartii: S70_16335Help
Entry
S70_16335         CDS       T02042                                 

Definition
bifunctional HisD: L-histidinal:NAD+ dehydrogenase/L-histidinol:NAD+ dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
psi  Providencia stuartii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:psi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3465016..3466320)
Genome map
AA seq 434 aa AA seqDB search
MGFNQPIRWSSCHANEQKALLTRPAIAASTNISAAVTQIIEQVKARGDSALIEFSQRFDK
TAISTIRVSQDAVEQAATRLDDNIKIAMQTAIGNIRRFHEAQKPAAIQVETQPGVVCQQI
TRPIDSVGLYIPGGSAPLLSTVMMLGTPANIAGCRQVILCSPPPIADEILYAAKLCGITD
IFQVGGAQAIAAMAFGTESIPAVDKIFGPGNAYVTEAKRQVSQDHEGAAIDMPAGPSEVL
VIADSQANPAFTAADLLSQAEHGPDSQVILLTDSQTFAQRVIDETEKQLAELSRADIARA
ALSASRVIIADSIAQCVEISNRYGPEHLILQTRNADELVEDITSAGSIFVGDWSPESAGD
YASGTNHVLPTYGYTSTYSSLGLADFMKRMTVQKLSPQGLLGLATTIETLAQAESLTAHK
NAVTLRVTELNKQK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgggatttaatcaaccgattcgctggtcatcatgtcatgctaatgaacaaaaagcgcta
ctgacacgccctgccatcgctgcgtctacaaacattagcgctgctgtcacccagatcatt
gaacaggtcaaagcccgcggtgatagtgcattaatcgaatttagccaacgttttgataaa
acagctatttcaactattcgtgtttcacaagatgctgttgaacaagccgcaacacgcctt
gatgacaacatcaaaattgcgatgcaaacggccatcggcaatatccgtcgttttcatgag
gctcagaaaccggcggctattcaagttgaaactcaacctggggttgtgtgccaacaaatt
acacgcccgatcgattccgtgggtctctatattcctggaggctcggccccccttctttca
acggtaatgatgttaggcacacccgcaaatattgcaggctgccggcaagtgatcctttgc
tcaccgccacctattgcagatgaaatactctatgccgctaaattgtgtggtattaccgat
attttccaagttgggggagcgcaagcaattgccgctatggcatttggaaccgaaagtatt
cccgccgttgataaaatttttggcccgggcaatgcctatgtgacagaggccaaacgccaa
gtcagccaagatcacgaaggggccgcaattgatatgccagcggggccatcagaagtgtta
gtcattgctgacagccaagccaaccctgcttttacagcggcggatctattatcgcaagca
gagcatggccctgattcacaagtcatattgttaaccgacagccaaacatttgctcaacgt
gttattgatgaaacggaaaaacagcttgcagagctatcgcgtgctgatattgcaagagca
gcattgagtgccagtcgtgtcattattgctgactccattgcacagtgcgttgaaataagt
aaccgctacggtccagaacatttaattctacaaacacgtaatgccgacgaattagtcgaa
gacatcaccagtgcgggatcgatttttgttggtgactggtcacctgaatccgcgggagat
tatgcatctggaactaaccacgtgttgccgacttacggttatacatcaacctattcaagt
cttggccttgctgattttatgaaacgtatgacagtgcaaaaactctcgcctcaagggctt
ctagggttagcgactaccattgaaacgttagcgcaagcagaaagcctaacggctcacaaa
aatgccgtgaccttacgtgtcactgaactgaacaaacaaaaatag

DBGET integrated database retrieval system