KEGG   Providencia stuartii: S70_17630Help
Entry
S70_17630         CDS       T02042                                 

Definition
cryptic 6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
psi  Providencia stuartii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_17630
Enzymes [BR:psi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     S70_17630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3710941..3712383
Genome map
AA seq 480 aa AA seqDB search
MSTAKFPKNFLWGGAISANQAEGAYRESGKGLTTVDMIPYGSHRMPVKLGLEQRYSLRKD
EYYPSHQSIDFYHHYKEDIALFAEMGFSVFRTSIAWSRLYPNGDELAPNAEGIAFYRDLF
NECKKYNIEPLVTLCHFDVPMHLVTEYGSWRNRKMVGFFSRYARTCFEEFNGLVKYWLTF
NEINIMLHSPFSAAGLVFKADEDPEQVKYQAAHHVLVASALATCIAHEVNPENQVGCMLA
GGGFYPWSCRPDDVWAALNKDRENLFFTDIQVRGYYPAYATRLFKEKNISLVVEPEDEAI
LTNTVDFVSFSYYTSRCTSAEMSEQNSSEANVVKSLKNPYIKVSDWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGFGAKDEVTEDGEINDDYRISYLRSHIRAMAEAIGDGIPVIGYTA
WSCIDLVAASTGELSKRYGFIYVDLDDQGRGTRERKKKNPSTGIKKSSRVMGRIWNNRIP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagcaaaattccccaagaatttcctttgggggggagctatctcagccaatcaa
gctgagggagcataccgtgaaagtggaaaagggctgaccacggtggacatgatcccttat
ggtagtcatcggatgccggttaaactggggttggaacaacgctatagcttacgtaaggat
gaatattaccccagtcaccaatctattgatttttatcatcactataaagaagacatcgca
ctgttcgcggaaatgggctttagtgtgtttagaacgtccatcgcatggagtcggctttat
cctaatggtgatgagttggcgcctaatgctgaaggcattgctttctatcgtgatctgttt
aatgagtgtaagaaatacaatattgagccactcgttactttatgccacttcgatgttccc
atgcacttggtgactgagtatggttcatggcgtaaccgaaaaatggtgggtttttttagc
cgctacgcgcgaacctgtttcgaagagtttaatggcttagtaaagtactggcttactttc
aatgaaatcaacattatgctgcacagccctttttctgccgcagggcttgttttcaaggct
gatgaagatcctgaacaggttaaatatcaagcagctcatcatgtgttagtggccagcgct
ttagcgacatgtattgcgcatgaagttaatcctgaaaaccaagttggctgtatgttagct
ggagggggattttatccttggtcatgtcgtcctgatgatgtatgggcggcactgaataaa
gatcgcgagaacctctttttcacggatatacaggtacgtggatattatccagcttatgca
actcgcttatttaaagagaagaacatttcgcttgttgtagagccagaagatgaagcgatt
ctcaccaataccgtcgattttgtctcttttagttactacacttcccgttgcacttccgca
gaaatgagcgagcagaatagcagcgaagccaacgtcgttaagtccttgaaaaacccctat
atcaaggttagtgattggggatggggtatcgatcccttgggcttacgtatcacgatgaat
atgatgtatgaccgttatcaaaaaccactttttttagtcgaaaatgggttcggtgcaaaa
gatgaagtgacggaagacggcgaaattaatgatgattatcggattagctacttacgtagc
catattcgtgctatggctgaggctattggggatggtattccggtaatcggctacacagca
tggtcttgtattgatttggttgctgcgtccactggggaattaagtaaacgctatggcttt
atttatgttgatcttgacgatcaaggtaggggaacacgtgaacgaaagaaaaaaaatcct
tctactggtatcaaaaagtcatcgcgagtcatggggaggatctggaataacagaatcccc
tag

DBGET integrated database retrieval system