KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_01945Help
Entry
PSJM300_01945     CDS       T02182                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00620  Pyruvate metabolism
psj00630  Glyoxylate and dicarboxylate metabolism
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSJM300_01945
   00630 Glyoxylate and dicarboxylate metabolism
    PSJM300_01945
Enzymes [BR:psj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSJM300_01945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFN76469
Position
complement(422987..425167)
Genome map
AA seq 726 aa AA seqDB search
MTERVQVGGLQVAKVLYDFVNNEAIPGTGVDAAAFWAGADSVIHDLAPKNRALLAKRDEL
QAQIDAWHQARAGQAHDAVAYKAFLQEIGYLLPEAEDFQATTQNVDEEITHMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEADGASKGPGYNEVRGNKVIAYARAFLDEAA
PLENGSHVDSTGYRVEGGKLVVSLKNGSTSGLKDSQQLLGFQGDASAPIAVLLKHNGIHF
EIQIDPSSPIGQTDAAGVKDILMEAALTTIMDCEDSIAAVDADDKTIVYRNWLGLMKGDL
VEELEKGGKRITRAMNPDRVYTKADGNGELTLHGRSLLFIRNVGHLMTNDAILDKEGNEV
PEGIMDGLFTSLAAMHNLKGNTTRKNTRTGSVYIVKPKMHGPEEVAFATELFGRVEDVLG
LARNTLKVGIMDEERRTSINLKACIKEARERVVFINTGFLDRTGDEIHTSMEAGPVVRKA
AMKAEKWISSYEDNNVDVGLACGLQGKAQIGKGMWAMPDLMAGMLEQKIGHPMAGANTAW
VPSPTAATLHALHYHKVDVFARQAELTQRAKASVDDILTIPLAKDTNWSEEEKRNELDNN
SQGILGYMVRWVEQGVGCSKVPDINDVALMEDRATLRISSQHMANWMRHGVVSQEQVVES
LKRMAPVVDRQNEGDPLYRPMAPDFDNSVAFQAALELVLEGTKQPNGYTEPVLHRRRREF
KAKNGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgttcaagtcggtggcctgcaggtcgccaaagtcctgtacgactttgtg
aacaacgaagcgattcccggtaccggcgtcgatgccgcggccttctgggccggtgccgac
agcgtcatccacgatctggcgccgaagaatcgcgctctgctggccaaacgcgacgaactg
caggcacagatcgatgcctggcatcaggctcgcgccggtcaggcccatgacgccgtcgcc
tacaaggccttcctgcaggaaatcggctatctgctgcccgaagccgaagacttccaggcc
accacccagaacgtcgacgaagaaatcacccacatggccggcccgcaactggtggtgccg
atcatgaacgctcgcttcgcgctcaacgccgccaacgcccgctggggttcgctgtatgac
gccctgtacggcaccgacgccatctccgaagcagatggcgccagcaagggcccgggctac
aacgaagttcgcggcaacaaggtcatcgcctacgcccgcgccttcctcgacgaggccgca
ccactggaaaacggctcgcacgtcgactccaccggctaccgcgtcgaaggcggcaagctg
gtcgtatcgctgaagaatggcagcaccagcggcctgaaggattcgcaacagctgctcggc
ttccagggcgacgccagcgcgccgatcgccgtgctgctcaagcacaacggcatccacttc
gagatccagatcgacccatccagccccatcggccagaccgacgccgccggcgtgaaggac
atcctgatggaagcggcgctgactaccatcatggactgcgaagactccatcgccgccgtc
gatgccgacgacaagaccatcgtctaccgcaactggctcggcctgatgaagggcgatctg
gtcgaggagctggaaaagggcggcaagcgcatcacccgcgccatgaaccctgatcgcgtc
tacaccaaggccgacggcaacggcgagctgaccctgcatggccgttccctgctgttcatc
cgcaacgtcggacacctgatgaccaacgatgccatcctcgacaaggaaggcaacgaagtg
ccggaaggcatcatggacggcctgttcaccagcctcgccgccatgcacaacctcaagggc
aacaccacgcgcaagaacactcgcaccggctcggtctacatcgtcaagccgaagatgcac
ggtccggaagaggtggccttcgcgaccgaactgttcggtcgcgtggaagacgttctcggc
ctggctcgcaacaccctgaaagtcggcatcatggacgaggagcgccgcacctcgatcaac
ctcaaggcctgcatcaaggaagcgcgcgagcgcgtggtgttcatcaacaccggcttcctc
gaccgcaccggcgacgagatccacacctccatggaagccggcccggtggtacgcaaggcc
gcgatgaaggccgagaagtggatcagctcctacgaggacaacaacgtcgacgtcggcctg
gcctgcggcctgcagggcaaggcacagatcggcaagggcatgtgggccatgcccgacctg
atggccggcatgctcgagcagaagatcggccacccgatggccggcgccaacaccgcctgg
gttccctcgccgaccgccgctaccctgcacgccctgcactaccacaaggtcgacgtgttc
gcccgtcaggccgagctgacccagcgcgccaaggcctcggtcgacgacatcctgaccatc
cccctggccaaggacaccaactggagcgaagaggaaaagcgcaacgagctggacaacaac
tcgcagggcatcctcggctacatggtgcgctgggtcgagcagggcgtgggctgctccaag
gtgccggacatcaacgatgtcgcgctgatggaagaccgtgccaccctgcgtatctccagc
caacacatggccaactggatgcgccacggcgtggtgagccaggagcaggtcgtcgaaagc
ctcaagcgcatggcgccggtggtcgaccgccagaacgaaggtgatccgctgtaccgcccg
atggcgccggacttcgacaacagcgtggccttccaggccgcgctggaactggtcctcgaa
ggcaccaagcagcccaacggctacaccgagccggtactgcaccgtcgccgccgcgagttc
aaggccaagaacggcctgtaa

DBGET integrated database retrieval system