KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_02020Help
Entry
PSJM300_02020     CDS       T02182                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:psj02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:psj02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
440748..441350
Genome map
AA seq 200 aa AA seqDB search
MKSVQPATSLSRRAPPIEAVVVGTSAGGLAALGVLVDGLAADRRSPLLVVQHVPAHGPTQ
LVEIFQRKTALRVKEAEDKESIVAGTLYFAVPGYHLLVEQDCSLSLSQDDAVHFSRPSID
VLFESAADAWGPRVAGILLTGANEDGAAGLQAIQRAGGLTVVQDPQEAEVTSMPLAALQR
ITPDYILPLRDIHRLLREME
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgtccagcctgcaacgtcgctctcgcgacgcgcgccgccgatcgaggcggtg
gtagtcggcacctccgcaggcggcctggcggccctgggggttctggtggacggcctcgcg
gctgaccggcggtcgcccttgctggtcgtccagcacgtgccggcccacggcccgacgcaa
ctggtggaaatcttccagcgcaagacggcgctgcgcgtgaaggaagccgaagacaaggag
tcgatcgtcgccggcacgctgtatttcgccgttcccggctaccacttgctggtggaacag
gattgcagcctctcgttgagccaggacgatgccgtgcatttctcgcggccttccatcgat
gtgctgttcgagtcggcggccgacgcctggggcccgcgcgtggcgggcatcctcctgacc
ggcgccaacgaggatggtgcggcaggcctgcaggccattcagcgcgccggtggcctgacg
gtggtgcaggacccgcaggaggccgaggtgacgagcatgccgctggcggccctgcaacgt
attaccccggactatattttgcctctgcgcgacatccaccgattgttgcgcgaaatggag
tga

DBGET integrated database retrieval system