KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_02020Help
Entry
PSJM300_02020     CDS       T02182                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:psj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSJM300_02020
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSJM300_02020
Enzymes [BR:psj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSJM300_02020
Two-component system [BR:psj02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PSJM300_02020
Bacterial motility proteins [BR:psj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSJM300_02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
440748..441350
Genome map
AA seq 200 aa AA seqDB search
MKSVQPATSLSRRAPPIEAVVVGTSAGGLAALGVLVDGLAADRRSPLLVVQHVPAHGPTQ
LVEIFQRKTALRVKEAEDKESIVAGTLYFAVPGYHLLVEQDCSLSLSQDDAVHFSRPSID
VLFESAADAWGPRVAGILLTGANEDGAAGLQAIQRAGGLTVVQDPQEAEVTSMPLAALQR
ITPDYILPLRDIHRLLREME
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgtccagcctgcaacgtcgctctcgcgacgcgcgccgccgatcgaggcggtg
gtagtcggcacctccgcaggcggcctggcggccctgggggttctggtggacggcctcgcg
gctgaccggcggtcgcccttgctggtcgtccagcacgtgccggcccacggcccgacgcaa
ctggtggaaatcttccagcgcaagacggcgctgcgcgtgaaggaagccgaagacaaggag
tcgatcgtcgccggcacgctgtatttcgccgttcccggctaccacttgctggtggaacag
gattgcagcctctcgttgagccaggacgatgccgtgcatttctcgcggccttccatcgat
gtgctgttcgagtcggcggccgacgcctggggcccgcgcgtggcgggcatcctcctgacc
ggcgccaacgaggatggtgcggcaggcctgcaggccattcagcgcgccggtggcctgacg
gtggtgcaggacccgcaggaggccgaggtgacgagcatgccgctggcggccctgcaacgt
attaccccggactatattttgcctctgcgcgacatccaccgattgttgcgcgaaatggag
tga

DBGET integrated database retrieval system