KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_02290Help
Entry
PSJM300_02290     CDS       T02182                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00010  Glycolysis / Gluconeogenesis
psj00030  Pentose phosphate pathway
psj00051  Fructose and mannose metabolism
psj00052  Galactose metabolism
psj00230  Purine metabolism
psj00500  Starch and sucrose metabolism
psj00520  Amino sugar and nucleotide sugar metabolism
psj00521  Streptomycin biosynthesis
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSJM300_02290
   00030 Pentose phosphate pathway
    PSJM300_02290
   00051 Fructose and mannose metabolism
    PSJM300_02290
   00052 Galactose metabolism
    PSJM300_02290
   00500 Starch and sucrose metabolism
    PSJM300_02290
   00520 Amino sugar and nucleotide sugar metabolism
    PSJM300_02290
  Nucleotide metabolism
   00230 Purine metabolism
    PSJM300_02290
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSJM300_02290
Enzymes [BR:psj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSJM300_02290
    5.4.2.8  phosphomannomutase
     PSJM300_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AFN76538
Position
complement(509615..512191)
Genome map
AA seq 858 aa AA seqDB search
MKLFKRGAKDPGALNPTDSKSSQRRPGGSLGGLLPGLACGLLGLGIAGALIGVGLQSSQQ
AHSAQVASAWGESQVSALDQALKQLASDTRGLAGDPQLIDVLLSGEPQRVRDAERDLALR
ANVFDAHLYRRDRASPRPDRAGPVTFAALDMLQRAENGETPAPEAYRIEGQWLLYSAIAL
QSAPNQPIQGTLLVVSPLDRLLATLPTLPADAGQMRLNQQFNKGPAQLLAQRGAGGLEEQ
ALDLPSSNPNWGLRFLPSSQASAAILPPLVLIGALLAALSGLLIALQLTLSGQQRRLRED
VLRMGQALQELSKGRAIKMPTLSLPALDALAKSLARLPLRAATPDAGKAPAPASVAAPQS
KPSEYVDPMFQTTDILDIDILDEDQDWMGLDTKERESAMSPKAPQLPASIFRAYDIRGVV
GDSLTTETAYWVGRAVGSESLARGEPNVSVGRDGRLSGPELVEHLIQGLVDSGCSVSDVG
MVPTPVLYYAANVLAGKSGVMLTGSHNPPDYNGFKIVIAGDTLANEQIQALRRRIETNDL
AEGIGQAEQVDVLESYFKRIREDIALAKPMRVVVDCGNGVAGVIAPQLIEALGCKVIPLF
CEVDGNFPNHHPDPGKLENLEDLIAKVKSENADLGLAFDGDRVGVVTNTGTVVYPDRLLM
LFAKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKETGALLAGE
MSGHIFFKERWYGFDDGIYSAARLLEILSQDKRTAEQVFAAFPNDLSTPEINITVTEESK
FAIIETLQRDAQWGEASVTTLDGLRVDYPKGWGLVRASNTTPVLVLRFEAESEEELKRIQ
DVFRAQLYTVAPDLKLPF
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttcaagcgcggcgccaaggaccctggcgcactcaaccccaccgacagcaaa
tcctcgcaacgccgtcccgggggcagtctgggcggcctgctgcccggcctggcctgcggg
ctgctcggcctgggcatcgccggcgcgctgatcggggtcggcctgcaatccagccagcag
gcacacagcgcacaggtcgccagtgcctggggcgaaagccaggtcagcgccctcgaccag
gcgttgaagcaactggcgtccgatacccgtggcctggccggcgacccgcaactgatcgac
gtcctgctcagcggcgagccgcagcgagtacgcgacgccgaacgcgatcttgcgcttcgc
gccaacgtcttcgatgcgcacctgtaccggcgtgaccgtgccagccccagacccgaccgg
gccggcccggtcaccttcgccgcgctggacatgctgcagcgcgccgagaatggcgagacg
cccgcgccggaagcctatcggatcgagggccagtggctgctctacagcgccattgcgctg
caatccgcgccgaatcagccaattcagggaacgctgctggtggtcagccccctcgaccgg
ctgctcgccacgctaccgacgcttccagccgacgccggccagatgcgcctgaaccagcaa
ttcaacaaggggcccgcgcaactgctggcccaacgcggcgcgggcgggctggaggagcag
gctctggacctgcccagcagcaacccgaactggggcctccgctttctgcccagctctcag
gcaagcgccgcgatactgccgccattggtgttgatcggtgcgctgctggccgctctcagc
ggcttgctgatcgccctgcagctgaccctgagcggccagcaacgacgcctgcgtgaagac
gttctgcggatgggccaggcactgcaggaactctcgaaaggcagagccatcaaaatgccg
accttgagcctgccggcactcgatgcgctggccaagagtctggcccgcctaccgttgcgg
gccgcgacgcctgacgcaggcaaggccccggccccggcgtcagttgccgcaccgcaaagc
aagcctagcgagtatgtcgaccccatgttccagaccaccgacattctcgacatcgatatt
ctcgacgaggaccaggattggatgggcctcgacaccaaggagcgagaaagcgcaatgagc
ccgaaagccccgcagttacctgccagcattttccgcgcctacgacattcgcggcgtggtc
ggcgacagcctgaccacggaaaccgcgtactgggtcggccgcgcggtcggctccgaaagc
cttgccaggggcgaacccaacgtctccgtgggccgcgacggccgactgtccggccccgag
ttggtcgaacatctgatccagggcctggtggacagcggctgcagcgtcagcgacgtcggc
atggtgccgactccggtgctctattacgcggccaacgtgctggccggcaaatccggcgtg
atgctcaccggcagccacaacccgccggactacaacggattcaagatagtcatcgctggc
gacaccctggccaacgagcagattcaggcgttgcggcggcgcatcgagaccaacgacctg
gccgaaggcatcggccaggccgagcaggtcgacgtgctggagagctacttcaagcgcatc
cgcgaggacatcgcgctggccaagccgatgcgggtggtggtcgattgcggcaacggcgtc
gccggcgtgatcgcgccgcaactgatcgaagccctgggttgcaaggtgattccgctgttc
tgcgaggtcgacggcaacttccccaatcaccatcccgacccgggcaaactggagaacctc
gaagacctgatcgccaaggtcaagtccgagaatgccgatctgggcctggccttcgacggc
gaccgcgtcggcgtggtgaccaacactggaaccgtggtctatccggaccgtctgctgatg
ctgttcgccaaggacgtggtctcgcgcaacccgggcgccgacatcatcttcgacgtcaaa
tgcacacgccgcctgacgccgctgatcagcggctacggcggccgcccggtgatgtggaag
accgggcattcgctgatcaagaagaagatgaaggaaaccggcgccctgctggccggcgag
atgagcggccatatcttcttcaaggagcgctggtacggcttcgatgacggcatctacagc
gccgcgcgactgctggaaattctcagccaggacaagcgcaccgccgaacaggtgttcgcc
gccttccccaacgacctgtcgacgccggaaatcaacatcaccgtcaccgaagagagcaag
ttcgcgatcatcgagaccctgcagcgcgacgcgcagtggggcgaagccagtgtcaccacg
ctcgacggcctgcgggtcgattacccgaagggctggggcctggtgcgcgcctccaacacc
acgccggtgctggtgctgcgcttcgaggccgagagcgaggaggagctcaagcgcatacag
gacgtcttccgcgctcagctttatactgtcgcgcctgatctcaaactgccgttctga

DBGET integrated database retrieval system