KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_02290Help
Entry
PSJM300_02290     CDS       T02182                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSJM300_02290
   00030 Pentose phosphate pathway
    PSJM300_02290
   00051 Fructose and mannose metabolism
    PSJM300_02290
   00052 Galactose metabolism
    PSJM300_02290
   00500 Starch and sucrose metabolism
    PSJM300_02290
   00520 Amino sugar and nucleotide sugar metabolism
    PSJM300_02290
  Nucleotide metabolism
   00230 Purine metabolism
    PSJM300_02290
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSJM300_02290
Enzymes [BR:psj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSJM300_02290
    5.4.2.8  phosphomannomutase
     PSJM300_02290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(509615..512191)
Genome map
AA seq 858 aa AA seqDB search
MKLFKRGAKDPGALNPTDSKSSQRRPGGSLGGLLPGLACGLLGLGIAGALIGVGLQSSQQ
AHSAQVASAWGESQVSALDQALKQLASDTRGLAGDPQLIDVLLSGEPQRVRDAERDLALR
ANVFDAHLYRRDRASPRPDRAGPVTFAALDMLQRAENGETPAPEAYRIEGQWLLYSAIAL
QSAPNQPIQGTLLVVSPLDRLLATLPTLPADAGQMRLNQQFNKGPAQLLAQRGAGGLEEQ
ALDLPSSNPNWGLRFLPSSQASAAILPPLVLIGALLAALSGLLIALQLTLSGQQRRLRED
VLRMGQALQELSKGRAIKMPTLSLPALDALAKSLARLPLRAATPDAGKAPAPASVAAPQS
KPSEYVDPMFQTTDILDIDILDEDQDWMGLDTKERESAMSPKAPQLPASIFRAYDIRGVV
GDSLTTETAYWVGRAVGSESLARGEPNVSVGRDGRLSGPELVEHLIQGLVDSGCSVSDVG
MVPTPVLYYAANVLAGKSGVMLTGSHNPPDYNGFKIVIAGDTLANEQIQALRRRIETNDL
AEGIGQAEQVDVLESYFKRIREDIALAKPMRVVVDCGNGVAGVIAPQLIEALGCKVIPLF
CEVDGNFPNHHPDPGKLENLEDLIAKVKSENADLGLAFDGDRVGVVTNTGTVVYPDRLLM
LFAKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKETGALLAGE
MSGHIFFKERWYGFDDGIYSAARLLEILSQDKRTAEQVFAAFPNDLSTPEINITVTEESK
FAIIETLQRDAQWGEASVTTLDGLRVDYPKGWGLVRASNTTPVLVLRFEAESEEELKRIQ
DVFRAQLYTVAPDLKLPF
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttcaagcgcggcgccaaggaccctggcgcactcaaccccaccgacagcaaa
tcctcgcaacgccgtcccgggggcagtctgggcggcctgctgcccggcctggcctgcggg
ctgctcggcctgggcatcgccggcgcgctgatcggggtcggcctgcaatccagccagcag
gcacacagcgcacaggtcgccagtgcctggggcgaaagccaggtcagcgccctcgaccag
gcgttgaagcaactggcgtccgatacccgtggcctggccggcgacccgcaactgatcgac
gtcctgctcagcggcgagccgcagcgagtacgcgacgccgaacgcgatcttgcgcttcgc
gccaacgtcttcgatgcgcacctgtaccggcgtgaccgtgccagccccagacccgaccgg
gccggcccggtcaccttcgccgcgctggacatgctgcagcgcgccgagaatggcgagacg
cccgcgccggaagcctatcggatcgagggccagtggctgctctacagcgccattgcgctg
caatccgcgccgaatcagccaattcagggaacgctgctggtggtcagccccctcgaccgg
ctgctcgccacgctaccgacgcttccagccgacgccggccagatgcgcctgaaccagcaa
ttcaacaaggggcccgcgcaactgctggcccaacgcggcgcgggcgggctggaggagcag
gctctggacctgcccagcagcaacccgaactggggcctccgctttctgcccagctctcag
gcaagcgccgcgatactgccgccattggtgttgatcggtgcgctgctggccgctctcagc
ggcttgctgatcgccctgcagctgaccctgagcggccagcaacgacgcctgcgtgaagac
gttctgcggatgggccaggcactgcaggaactctcgaaaggcagagccatcaaaatgccg
accttgagcctgccggcactcgatgcgctggccaagagtctggcccgcctaccgttgcgg
gccgcgacgcctgacgcaggcaaggccccggccccggcgtcagttgccgcaccgcaaagc
aagcctagcgagtatgtcgaccccatgttccagaccaccgacattctcgacatcgatatt
ctcgacgaggaccaggattggatgggcctcgacaccaaggagcgagaaagcgcaatgagc
ccgaaagccccgcagttacctgccagcattttccgcgcctacgacattcgcggcgtggtc
ggcgacagcctgaccacggaaaccgcgtactgggtcggccgcgcggtcggctccgaaagc
cttgccaggggcgaacccaacgtctccgtgggccgcgacggccgactgtccggccccgag
ttggtcgaacatctgatccagggcctggtggacagcggctgcagcgtcagcgacgtcggc
atggtgccgactccggtgctctattacgcggccaacgtgctggccggcaaatccggcgtg
atgctcaccggcagccacaacccgccggactacaacggattcaagatagtcatcgctggc
gacaccctggccaacgagcagattcaggcgttgcggcggcgcatcgagaccaacgacctg
gccgaaggcatcggccaggccgagcaggtcgacgtgctggagagctacttcaagcgcatc
cgcgaggacatcgcgctggccaagccgatgcgggtggtggtcgattgcggcaacggcgtc
gccggcgtgatcgcgccgcaactgatcgaagccctgggttgcaaggtgattccgctgttc
tgcgaggtcgacggcaacttccccaatcaccatcccgacccgggcaaactggagaacctc
gaagacctgatcgccaaggtcaagtccgagaatgccgatctgggcctggccttcgacggc
gaccgcgtcggcgtggtgaccaacactggaaccgtggtctatccggaccgtctgctgatg
ctgttcgccaaggacgtggtctcgcgcaacccgggcgccgacatcatcttcgacgtcaaa
tgcacacgccgcctgacgccgctgatcagcggctacggcggccgcccggtgatgtggaag
accgggcattcgctgatcaagaagaagatgaaggaaaccggcgccctgctggccggcgag
atgagcggccatatcttcttcaaggagcgctggtacggcttcgatgacggcatctacagc
gccgcgcgactgctggaaattctcagccaggacaagcgcaccgccgaacaggtgttcgcc
gccttccccaacgacctgtcgacgccggaaatcaacatcaccgtcaccgaagagagcaag
ttcgcgatcatcgagaccctgcagcgcgacgcgcagtggggcgaagccagtgtcaccacg
ctcgacggcctgcgggtcgattacccgaagggctggggcctggtgcgcgcctccaacacc
acgccggtgctggtgctgcgcttcgaggccgagagcgaggaggagctcaagcgcatacag
gacgtcttccgcgctcagctttatactgtcgcgcctgatctcaaactgccgttctga

DBGET integrated database retrieval system