KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_02540Help
Entry
PSJM300_02540     CDS       T02182                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSJM300_02540
Enzymes [BR:psj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PSJM300_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563307..564068
Genome map
AA seq 253 aa AA seqDB search
MTGWRLLLTRPTEECAALAATLAQAGVHSASLPLLSIEPLPETPAQHALMRELDRYCAVV
VVSKPAARLGIEWLDRYWPQPPFAQPWFSVGAATGTILRDHGLDVSWPDTGDDSEALLAL
PRLSEALAVPSPRVLILRGEGGREFFAETLRGRGVPVDFLELYRRNLPSHPPGALPATIE
AERLNGLVVSSGQGLQSLRELAADAWPEMVELTLFVPSPRVAEMARQLGAKRIVDCRGAG
AAALLTALRETAP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggctggcgtctgctgctgacccggcccaccgaggagtgcgccgcgctggcggcc
acgctggcccaggctggcgttcacagcgccagcctgccgctgctgagcatcgagccgctg
cccgagacgcccgcacagcacgcgctgatgcgcgagctggatcgctactgcgccgtggta
gtggtcagcaaaccggccgcgcgcctgggtatcgaatggctggaccgctactggccgcag
ccgccattcgctcagccgtggttcagtgtcggcgccgccaccggcacgatcctccgggac
catgggctggatgtcagctggcccgatacgggggatgacagcgaagcgctgctggccctg
ccgcgcctgagcgaggcgctggcggttccgagccccagggtgctgatcctgcgtggcgag
ggcggacgcgagttcttcgccgaaaccctgcgtggccgtggcgtgccggtggattttctc
gagctctaccgacgcaacctgccgagccatcctccgggagcgctgccggcgaccatcgaa
gcggaacggctcaacggcctggtggtcagcagtgggcagggtctgcagtcgctgcgtgaa
ctggctgctgatgcctggcctgagatggttgagctaaccttgttcgtacccagcccgcgt
gtggccgagatggcgcggcagctgggtgccaaacgaatcgtggattgccgtggcgctggt
gccgcggccttgctgacggccttgcgcgagaccgccccttga

DBGET integrated database retrieval system