KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_03110Help
Entry
PSJM300_03110     CDS       T02182                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PSJM300_03110
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     PSJM300_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701516..703432
Genome map
AA seq 638 aa AA seqDB search
MSDNDSKNTPQTLEKNGLSRRGFLGASALTGAAVAATALGGAVMSRESWAAAVKDAQSKI
HVGPGELDEYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRAIMGDS
AKFLNGDCHHPHISMTNGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGL
RLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAESMEMAFQVIVDGNLD
NTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAIEKAVKAGKFITLGDSKV
PVVDGRKKDGKNSEFTRYVPVPKNPHGLNTSSDGKYFIANGKLSPTCSMIAIDMLPDLFA
GKLKDERDVVVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEARRAYKGEKVNY
IKQKLDVHYQPGHLHASLCETSEADGKWLVALSKFSKDRFLPTGPLHPENDQLIDISGDE
MKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVKMAEKDGINLTTDNKVIRD
GNKVRVYMTSMAPAYGITDFTVKQGDEVTVVVTNIDQIEDVSHGFVVVNHGVSMEISPQQ
TSSITFVADKPGLHWYYCSWFCHALHMEMVGRMIVEPA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatgattccaagaacaccccgcaaacgctggagaagaacggcctgagtcgc
cgcggcttcctcggcgccagtgccctgaccggtgccgcggtggcggccactgccctgggt
ggtgctgtcatgagccgcgaaagctgggcggcagccgtcaaggacgcacaatccaagatt
cacgtcggcccgggcgaactggacgagtattacggcttctggtccggcggtcaccagggc
gaagtccgcgtgctgggcgtaccgtccatgcgcgagctgatgcgtattccggtgttcaac
gtcgactccgccaccggctggggcctgaccaacgaaagccgcgcgatcatgggcgacagc
gccaagttcctgaacggcgactgccaccacccgcacatctccatgaccaacggcaagtac
gacggcaagtacctgttcatcaacgacaaggccaacagccgcgtcgcgcgtatccgcctc
gacatcatgaagtgcgacaagatgatcaccgtgccgaacgtgcaggcgatccacggtctg
cgtctgcagaaggtgccgcacaccaagtacgtcttcgccaacgccgagttcatcatcccg
cacccgaacgatggcaaggtcttcgacctgcaggatgagaacagctacaccatgtacaac
gccatcgatgcggaaagcatggagatggccttccaggtgatcgtcgacggcaacctcgac
aacaccgacgccgactacaccggccgcttcgccgctgctacctgctacaactcggagaag
gccttcgacctgggcgggatgatgcgcaacgagcgtgactgggtggtggtattcgacatc
cacgcgatcgaaaaagccgtcaaggccggcaagttcatcaccctgggcgactccaaggta
ccggtggtcgatgggcgcaagaaggacggcaagaacagcgagttcacccgctacgtgccg
gtgccgaagaacccccatggcctgaacacttcttccgatggcaagtacttcatcgccaac
ggcaagctgtcgccgacctgctcgatgatcgccatcgacatgctgcccgacctgttcgcc
ggcaaactgaaggacgagcgtgacgtggtggtcggtgagccggaactgggtctcggcccg
ctgcacaccaccttcgacggtcgcggcaacgcctacaccacgctgttcatcgacagccag
gtggtcaagtggaacatggaagaggcccgtcgcgcctacaagggcgagaaggtcaactac
atcaagcagaagctcgacgtgcactaccagccgggccacctgcacgcctcgctgtgcgaa
accagcgaagccgacggcaagtggctggtggcgctgtccaagttctccaaggaccgcttc
ctgcctaccggcccgctgcacccggaaaacgatcagctgatcgatatctccggcgacgag
atgaagctggtgcacgacggcccgactttcgccgagccgcacgactgcatcatggcccgc
cgcgatcagatcaagaccaagaagatctgggaccgcaacgatccgttcttcgcgccgacc
gtgaagatggccgagaaggacggtatcaacctgactaccgacaacaaggtcatccgcgac
ggcaacaaggttcgtgtctacatgacctccatggcgccggcctacggcatcaccgacttc
accgtgaagcagggtgacgaagtgactgtcgtggtgaccaacatcgaccagatcgaagac
gtgtcccacggcttcgtggtggtcaaccatggcgtgagcatggagatcagcccgcagcag
acctcgtccattaccttcgtggcggacaagcccggcctgcactggtactactgcagctgg
ttctgccacgcgctgcacatggagatggtcggccgcatgatcgtcgaaccggcctga

DBGET integrated database retrieval system