KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_03875Help
Entry
PSJM300_03875     CDS       T02182                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:psj00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:psj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859096..860361
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGTRLDGEIRISGAKNSALPILAATLLADTPVTVCNLPHLHDITTMIELFGRM
GVQPIIDEKLSVEVDASSIQTLVAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAQIDVEGGYIKAKAPAGGLRGANFFFDIVSVTGTENIMMAAALAN
GRSVLENAAREPEVVDLANFLNAMGAQISGAGTDTITIDGVKRLGGGRYSVMPDRIETGT
YLVAAAATGGRVKLKDTDATLLEAVLHKLEEAGAHIDTGKDWIELNMKGNRPRAVNVRTA
PYPAFPTDMQAQFIALNAIAEGTGTVIETVFENRFMHVYEMNRMGAQILVEGNTAIVTGV
PRLKGAPVMATDLRASASLVLAGLVAEGDTLIDRIYHIDRGYECIEEKLQLLGAKIRRVA
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgatcatcaccggcggtacccgcctcgacggcgaaatccgcatttccggc
gcgaagaactcggcgttgccgatcctcgccgcgaccttgctggccgacacgccggtcacc
gtctgcaacctgccgcacctgcacgacatcaccaccatgatcgagctgttcggccgtatg
ggcgtgcagccgatcatcgacgagaagctcagcgtcgaagtcgatgccagcagcatccag
acgctggtggcgccctatgaactggtcaagaccatgcgcgcctcgatcctggtgctgggc
cccatggtcgcgcgcttcggcgaagccgaagtggccctgccgggcggttgtgccatcggc
tcgcggcctgtcgacctgcacattcgcggcctggaagccatgggcgcgcagatcgatgtc
gaaggcggctacatcaaggccaaggcgcctgccggcggtctgcgcggtgcgaacttcttc
ttcgatatcgtcagcgtgactggtaccgagaacatcatgatggccgccgccctggccaac
ggtcgcagcgtgctggagaacgccgctcgcgagcctgaggtggtcgacctggccaacttc
ctcaatgcgatgggcgcgcagatctccggcgccggtaccgacaccatcaccatcgacggc
gtcaaacgtctcggtggcggtcgctacagcgtgatgcccgaccgcatcgagaccggtacc
tacctggtggccgcagccgcaaccggtggccgcgtaaagctcaaggacaccgatgccacc
ttgctcgaagcggtgctgcacaagctcgaggaagccggcgcccatatcgataccggcaag
gactggatcgaactgaacatgaagggcaaccgcccgcgggccgtcaacgtgcgcacggcg
ccgtatccggcgttccccaccgacatgcaggcgcagttcatcgccctgaacgccatcgcc
gaaggcaccggcaccgtgatcgaaacggtgttcgagaatcgcttcatgcacgtttacgag
atgaaccgcatgggcgcgcagattctcgtcgagggcaacacggccatcgtcaccggcgtg
ccgcggctcaagggcgccccagtgatggctaccgatctgcgcgcctccgccagcctggtc
ctcgccggcctggtggccgagggcgataccctgatcgaccgcatctaccacatcgaccgt
ggctacgagtgcatcgaggaaaagctgcagctgctgggcgccaagattcgccgcgtggcg
ggctga

DBGET integrated database retrieval system