KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_04605Help
Entry
PSJM300_04605     CDS       T02182                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psj  Pseudomonas stutzeri DSM 10701
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1019623..1020348
Genome map
AA seq 241 aa AA seqDB search
MRVSRLFAAVALGLASSLSVAADPDKAIREALNAIQPGMPIEAVAESPMPGVYQVQLKGG
RQLYASADGQFVIQGYLFQFKDGEALNLTEQAQSQSVAATINAVALKDMVIFAPEKPKTH
ITVFTDTDCGYCQKLHSEVPELNRLGVEVRYMAFPRQGMGSHGANTLTSVWCAKNPQEAM
NKAKARDEVPAATCDNPVAEQYQLGQLIGVQGTPAIVLADGQIIPGYQPAPQLAELALQA
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgagtcgtctgttcgctgccgtggccttgggcctggcttcctccctgtccgtc
gccgccgatcccgacaaggccatccgcgaggcgctgaatgccattcagccaggcatgccg
atcgaggccgttgccgaaagccccatgccgggtgtctatcaggtgcagctcaagggtggg
cgccagctctatgccagtgccgacggtcagttcgtcattcagggctacctgttccagttc
aaggatggcgaggcgctgaacctcaccgaacaggcgcagagccagtcggtcgcggccacc
atcaatgcggttgcgctcaaggacatggtgatcttcgcgccggagaagcccaagacccac
atcacggtgttcaccgacaccgattgcggctattgccagaagctgcacagcgaagttccg
gaactgaaccgtctgggcgtggaagttcgctacatggcgtttccgcgccagggaatgggc
agccatggcgccaacaccctgaccagcgtctggtgcgccaagaacccgcaggaggcgatg
aacaaggccaaggcgcgcgacgaggttcctgccgccacctgtgacaatccggtcgccgag
cagtatcagctgggtcagctcatcggcgtacagggcacgccggccatcgtcctcgccgac
ggtcagatcatccccggctaccagccggctccgcagctggcggaactcgcgctccaggcc
aagtga

DBGET integrated database retrieval system