KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_04620Help
Entry
PSJM300_04620     CDS       T02182                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSJM300_04620
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSJM300_04620
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSJM300_04620
Enzymes [BR:psj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSJM300_04620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1022498..1023922
Genome map
AA seq 474 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLARDGGLYVPENLPRFTVEEIASWSGLPYHELAFKVMR
PFVAGSIPDADFKQILEETYSSSGQGVFAHSAVAPLRQLDGNEWVMELFHGPTLAFKDFA
LQLLGRLLDYVLAKRGERVVIIGATSGDTGSAAIEGCRRCENVDIFILHPHNRVSEVQRR
QMTTILGDNIHNIAIEGNFDDCQEMVKDSFADQGFLKGTRLVAVNSINWARIMAQIVYYF
HAALQLGGPARSVAFSVPTGNFGDIFAGYLARNMGLPISQLVVATNRNDILHRFMSGNRY
DKDTLHPSLSPSMDIMVSSNFERLLFDLHGRNGAAVAELMNAFKASGKLSVEEERWTEAR
KLFDSLAVDDEQTCKTIAEVFAATGEVLDPHTAIGVHAARECRRSLATPMVILGTAHPVK
FPEAVEKAGVGKALELPAHLADLFERPERCSVLANDLKAVQNFVSEHGNRGKPL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatcagtacccgtggccaggctccggccctgaatttcgaagatgtgctgctg
gccggactggcccgcgatggcggcctctatgtgccggaaaacctgccgcgcttcaccgtc
gaggaaatcgcctcctggtccggcctgccatatcacgaactggccttcaaggtgatgcgc
cccttcgtggccggcagcattccggacgccgacttcaagcagattctcgaagaaacctat
tcttcatcagggcagggcgtattcgcccacagcgcggttgcgccgctgcggcagctggat
ggcaacgaatgggtgatggagctgttccacggcccgaccctggcgttcaaggatttcgcc
ctgcaactgctcggtcgcctgctcgactacgtgctggccaagcgtggcgagcgcgtggtg
atcatcggcgccacctccggcgataccggctcggcggcgatcgaaggctgccgtcgctgc
gagaacgtcgacatcttcatcctgcatccgcacaaccgcgtctcggaagtgcagcgccgg
cagatgaccaccatcctcggcgacaacatccacaacatcgccatcgaaggcaacttcgac
gactgccaggaaatggtcaaggacagcttcgccgaccagggcttcctcaaaggcacccgc
ctggtggcggtgaactcgatcaactgggcgcggatcatggcccagatcgtctactacttc
cacgccgcgctgcagttgggcggcccggcgcgctcggtggccttctcggtgccgaccggc
aacttcggcgacatcttcgccggctacctggcgcgcaacatggggctgccgatcagccaa
ctggtggtcgcgaccaaccgcaacgacatcctgcaccgcttcatgtccggcaaccgctac
gacaaggacacgctgcatccgtcgctgtcgccgtccatggacatcatggtctcgtccaac
ttcgagcgtctgctgttcgacctgcacggccgcaacggggccgccgtggccgaactgatg
aacgccttcaaggccagcggcaagctgtcggtcgaggaagagcgctggaccgaggcgcgc
aagctgttcgattccctggcggtggacgacgagcagacctgcaagaccatcgccgaggtg
ttcgcggccaccggcgaagtgctcgacccgcataccgctatcggtgtccatgccgcacgc
gaatgccgccgcagcctggcaacgccgatggtgatcctgggcaccgcgcatccggtgaaa
ttccctgaggcggtggagaaggccggagtcggcaaggcgctggaactgccggcacacctg
gcggacctcttcgagcgtcccgagcgctgcagcgtgctggcgaacgacctcaaggccgtg
cagaacttcgtcagtgaacacggcaatcgcggcaagccgttgtaa

DBGET integrated database retrieval system